CAZyme Information: MGYG000004518_00645

Basic Information

• Species: Zag111 sp002103105
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp002103105
• CAZyme ID: MGYG000004518_00645
• CAZy Family: GH57
• CAZyme Description: 1,4-alpha-glucan branching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000004518_2|CGC1	66520.1	5.7891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004518	1841689	MAG	Israel	Asia

• Gene Location: Start: 45599; End: 47323 Strand: -

Full Sequence      

MAVGQFVFMLHSHLPYYRKAGMWPFGEENLYECMSETYVPLLNAISELYDEGIKAKLTVG
ITPILAEQLNDEHLKNGFVEYLDSRIASVSKDLERYPDPKVPHSQHLKYLAKYYFDWFNS
IKDSFVNKYQMDLVGAFKKFQDLGCIEITTSGATHGFSPLLATDNNLNAQFKVGSDTTKR
LFGKKAKGCWLPECAYRQGYEYIGKDGQKHWRPAIEVTLQNNDIEYFFTESHVIEGGNSI
GSRRVVGVYGNIEYIPLPEREPTGYDTYSAYWLPDAQVAVMGRNDRAGYQVWSAADGYPG
DGCFREFHKKDDKSGMNYWRITSPKTDLGDKMLYDPVLALNKINENSDHYTTMLYHLLND
YKNSHNGKEGLIMVSFDTELFGHWWFEGIEFIKQVIKKFNQYLPQVERMTAGEYLHAHPP
TEAIQIPESSWGQGGHFYVWNNHLTEWMWPIIHSCEKRITSIADRYPNIPDNKLLHRALN
QLARENLLLQSSDWPFLITTWQAKDYATDRFREHVDRFEEIADMIDANNIDESKLQKIES
IDNCFPVIDYRVYQSIEEGLIPQQSKKLAPLYKD

Enzyme Prediction     

EC	2.4.1.18	3.2.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	7	444	5.7e-68	0.783289817232376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10816	GH57N_BE_TK1436_like	1.07e-161	4	442	1	423	N-terminal catalytic domain of Gh57 branching enzyme TK 1436 and similar proteins. The subfamily is represented by a novel branching-enzyme TK1436 of hyperthermophilic archaeon Thermococcus kodakaraensis KOD1. Branching enzymes (BEs, EC 2.4.1.18) play a key role in synthesis of alpha-glucans and they generally are classified into glycoside hydrolase family 13 (GH13). However, TK1436 belongs to the GH57 family. It functions as a monomer and possesses BE activity. TK1436 is composed of a distorted N-terminal (beta/alpha)7-barrel domain and a C-terminal five alpha-helical domain, both of which participate in the formation of the active-site cleft.
COG1543	COG1543	2.62e-152	2	555	1	503	Predicted glycosyl hydrolase, contains GH57 and DUF1957 domains [Carbohydrate transport and metabolism].
cd10792	GH57N_AmyC_like	6.03e-110	4	442	1	412	N-terminal catalytic domain of alpha-amylase ( AmyC ) and similar proteins. Alpha-amylases (alpha-1,4-glucan-4-glucanohydrolases, EC 3.2.1.1) play essential roles in alpha-glucan metabolism by catalyzing the hydrolysis of polysaccharides such as amylose starch, and beta-limit dextrin. This subfamily is represented by a novel alpha-amylase (AmyC) encoded by hyperthermophilic organism Thermotoga maritime ORF tm1438, and its prokaryotic homologs. AmyC functions as a homotetramer and shows thermostable amylolytic activity. It is strongly inhibited by acarbose. AmyC is composed of a N-terminal catalytic domain, containing a distorted TIM-barrel structure with a characteristic (beta/alpha)7 fold motif, and two additional less conserved domains. There are other two canonical alpha-amylases encoded from T. maritime that lack the sequence similarity to AmyC, and belong to a different superfamily.
cd01022	GH57N_like	4.80e-55	8	442	2	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.
pfam09210	DUF1957	4.98e-41	455	553	2	98	Domain of unknown function (DUF1957). This domain is found in a set of hypothetical bacterial proteins. Its exact function has not, as yet, been defined.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39099.1	0.0	1	573	1	572
ABX07093.1	5.52e-163	4	557	5	645
QPC81774.1	3.03e-160	2	551	3	572
AIF69759.1	5.88e-143	1	566	1	548
AHF79441.1	1.37e-142	1	563	1	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WU7_A	4.72e-133	4	562	3	542	Crystalstructure of GH57-type branching enzyme from hyperthermophilic archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5WU7_B Crystal structure of GH57-type branching enzyme from hyperthermophilic archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3N8T_A	7.84e-133	4	548	3	527	ChainA, alpha-amylase, GH57 family [Thermococcus kodakarensis],3N92_A Chain A, alpha-amylase, GH57 family [Thermococcus kodakarensis],3N98_A Chain A, alpha-amylase, GH57 family [Thermococcus kodakarensis]
3P0B_A	1.68e-116	3	553	21	535	Thermusthermophilus family GH57 branching enzyme: crystal structure, mechanism of action and products formed [Thermus thermophilus]
1UFA_A	4.51e-114	5	553	3	515	Crystalstructure of TT1467 from Thermus thermophilus HB8 [Thermus thermophilus]
2B5D_X	6.18e-82	4	552	3	522	Crystalstructure of the novel alpha-amylase AmyC from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5JDJ7	1.22e-130	4	548	3	527	1,4-alpha-glucan branching enzyme TK1436 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1436 PE=1 SV=1
Q5SH28	5.04e-116	3	553	1	515	1,4-alpha-glucan branching enzyme TTHA1902 OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1902 PE=1 SV=1
P9WQ26	4.97e-51	4	534	10	503	Probable 1,4-alpha-glucan branching enzyme MT3115 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3115 PE=3 SV=1
P9WQ27	4.97e-51	4	534	10	503	Probable 1,4-alpha-glucan branching enzyme Rv3031 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3031 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004518_00645.