CAZyme Information: MGYG000001504_00391

Basic Information

• Species: Mt11 sp001282665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tepidimicrobiaceae; Mt11; Mt11 sp001282665
• CAZyme ID: MGYG000001504_00391
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724	MGYG000001504_12|CGC4	84298.39	4.8318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001504	3566389	Isolate	not provided	not provided

• Gene Location: Start: 404985; End: 407159 Strand: +

Full Sequence      

MKLSIRTIASLFTCLFISANLVGCSKKNSLSSKGIRYKFKDLIDVKGVPIKAVPNDTYEI
NPFSDMGAWHAYHLPGIDDKEYYGGFTGPLYIAQEYGRWLSKSFNIIKIYDKQREKEIKL
ADCKDLDLSYYPGLLVQRYDMEDFILNLELRFVTNRTALVTTKIKNKTDRELNLKLNWEG
ELLKDFEPNNSEILDIRLEASTNGVKVKFPDVDDTWNVFTSKEMEYELLYPFEVKTKING
DKYIIEIEDISIKPKKEYILNTANTYTFTKDEKDKENEKVKDIFKNPSKYIEDNDLRWEN
YLANSLKGENRDYDRLAVKTVETLTTNWRSSAGEIKKDGITPSMSYKWFNGMWAWDSWKQ
AVAVTNFAPELAKENIRAIFDYQREDGMIIDAIFYNKSRYNYFGEKGGNWNERNSKPPLA
SWAVWEVYESTKDKEFLKEMYPKLVKYHDWWYIARDNDKNGIAEYGGSVDPLNNTEEEMI
LAAAWESGMDNAIRFDTDYGVKVMENIDENGRLVGYSINQESVDLNSYLYAEKKYLGKIA
EILNKTSDVDRYEREAEYVKDFIQKNMFDRETGFFYDIDILTKKPLINRGKGIEGVIPLW
AEVASKEQAEMVKDILIDEDKFNTKVPFPTASKDNPRYNSEVYWRGPVWLDQAYFAIKAL
DKNGYKDEANKLAKKIVENIEGAMIDGEVIRENYNSENGEGLHCTNFSWSAGMLYLLCKE
YLMQ

Enzyme Prediction     

No EC number prediction in MGYG000001504_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	9	722	1.3e-200	0.9859649122807017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	1	722	1	784	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.08e-19	415	721	178	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	5.34e-19	310	714	252	599	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	3.19e-13	415	721	203	544	alpha,alpha-trehalase
pfam03200	Glyco_hydro_63	2.18e-12	427	711	176	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY84390.1	2.91e-260	39	720	41	764
AMN34579.1	7.35e-259	16	722	23	754
AYE34630.1	1.21e-257	39	720	40	751
QAS60029.1	1.21e-257	39	720	40	751
AQM60257.1	3.93e-257	39	720	41	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.42e-155	39	721	5	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	7.93e-155	39	721	5	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.12e-154	39	721	5	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	6.81e-150	39	721	6	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	1.06e-87	39	481	331	782	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.08e-154	3	721	1	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.74e-19	353	713	98	480	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.32e-19	353	713	98	480	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	5.26e-12	411	664	108	319	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
Q54QZ5	1.93e-10	415	721	244	585	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000156	0.999907	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001504_00391.