CAZyme Information: MGYG000002331_00158

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_00158
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896		100567.6	4.4846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 152050; End: 154740 Strand: +

Full Sequence      

MFKKSTLAILIGATISLVGCGSNDKTEIRLPQAPTSEFTNVIDRTGNPTYLRDYDSYSNL
KYNALTDNGAWHGHLLPEDAAGYGAFGGIMQVTQEYAHFMSGQTFDKLTLTDKVSGQTYD
LSNAEAKVYSIPGALVQVLDLDDIHVQMVLRFVTDRSSLVETLITNKTDRDMNLALEWDG
ELVKYALSTRKDQTVAQYYPDYKRQISTIENGIKINFSEMKDNWAIRNDRDAEFRITRSL
PTKTFTNETSFSSTAEMSLPAEQTSAVYTAYSNLHNAKEVQSESLKLQDVLANPTQYMEA
SKARWDGYLANGLINKEATADQARVAVKAMETLNGNWRSAAGDIEQATVTPSVTARWFSG
NLTWPWDSWKQAYAMAHFNPDVAMDNIRTVFQEQVQADDKIRPQDKGYLLDVLTYTKPVS
RGGAGSENWNERNTKPSLAAWSVMEVYHALVNQFDRPEDAQKFIDEMYPKLVAYHDWWLS
NRDHNQNGVPEYGAAVDPAHNTEEGVMYVWVETRDPNFTTIIPAEDIIEQNGNSYKVKGM
ASYNKILDEVDYMTIHVGAQEAAGWESGMDNAARFGFIYNIHNMNSQAEDISNPDRNVDQ
LGRYAASAYGFDNSIKLEGEEWVYSNTSAENLAKLDLAKKDWEVRFAENRTNNNAADGEL
LGFSMLQESVDQASYMYSDNKYLAEMAKLVSDGVEGKDRAQEFLNGAEKIKTYINQCMFD
ESTGFFYDIHLNVAEDGTTPAPLANGCAGLPIVERGRGPEGWSPLFNGAATQEHADKVIA
VMRDQDEFNTPDKFQGTGVPLPTASQTNPAYGKDVYWRGRVWLDQVYFGFRAMENYGYKE
EAIAMANELFNNAEGMTGDMPIRENYNPETGAVQGASNFSWSAAHLYMMYNGFFKN

Enzyme Prediction     

No EC number prediction in MGYG000002331_00158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	2	895	2e-262	0.9982456140350877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	2	895	1	785	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	1.53e-07	670	889	252	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	5.16e-04	670	879	305	486	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNE55225.1	0.0	1	896	1	896
QQD00876.1	0.0	1	896	1	896
QWL01953.1	0.0	1	896	1	896
AGB11467.1	0.0	1	896	1	896
BCB44003.1	0.0	1	896	1	896

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.36e-273	38	895	5	758	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	7.77e-273	38	895	5	758	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.10e-272	38	895	5	758	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.29e-262	33	895	1	759	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	7.35e-151	19	512	312	786	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	8.27e-273	33	895	23	781	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_00158.