CAZyme Information: MGYG000004865_00102

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; RUG023
• CAZyme ID: MGYG000004865_00102
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000004865_2|CGC1	54720.88	5.5537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004865	2913052	MAG	China	Asia

• Gene Location: Start: 36695; End: 38119 Strand: +

Full Sequence      

MIKDLVPFVHFYDQDFVDMYDRSWVWIDELWKSGTKENGFEGEYLSYPGQTTFNQFSSCF
STLFLVYSNQNNSPFPSLDFFYKKQEDNGAIRGEYSVANGKPVLTADNPEGVFPPLFSYM
EFQFYHKIGNKKRLKEIMPVLEKHYAWLVQKFQKPNGLFSVPVSACQTGNIKREGAVYPV
DFNAIVALHVLYLSAIGDILNDKEISFKYKRIYFGLKTRINSMMWDPETKFYYDLDANEK
RLDVKHIGAFWVLLAEVPNEERADDLIATLKDPKEFGTENPFPGVPISSPAFREEGDGLN
GGVSTIFTYMVVKGLEKYHEFVFARECAIRHMYFLLDTLHPDAETMGDVWEVYLPNKEGY
STSKDLPGFPKRRFMPSTGLVSITMMIEDIIGLDISLPRKTVNWVMPSLEAMGIERLSLK
RNMITILSNKTDRGWEIRLESEKLYYFTIEILDEQKKKTLPIPSGKCSMLIDKL

Enzyme Prediction     

No EC number prediction in MGYG000004865_00102.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1626	TreA	3.01e-58	1	474	47	548	Neutral trehalase [Carbohydrate transport and metabolism].
PRK10137	PRK10137	1.29e-12	180	318	578	726	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.12e-07	172	330	297	454	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	0.002	81	431	311	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV29734.1	7.34e-286	1	474	1	474
ADY14846.1	1.16e-282	1	474	1	474
AEC03045.1	1.44e-237	1	474	1	477
ADK79245.1	1.75e-210	7	474	12	479
QEN04796.1	3.44e-201	2	474	3	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.38e-07	192	318	563	699	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	1.38e-07	192	318	563	699	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	1.38e-07	192	318	563	699	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.47e-07	192	318	112	248	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.47e-07	192	318	112	248	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.57e-146	1	474	1	474	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	7.66e-07	192	318	586	722	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999439	0.000496	0.000041	0.000005	0.000002	0.000025

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004865_00102.