CAZyme Information: MGYG000000161_00261

Basic Information

• Species: Lactobacillus amylovorus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus amylovorus
• CAZyme ID: MGYG000000161_00261
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000000161_4|CGC1	25063.93	10.2768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000161	2049624	Isolate	China	Asia

• Gene Location: Start: 36192; End: 36839 Strand: -

Full Sequence      

MAKKRKSRIPKSVKLVVRVFIILFVLMIAFVGFRYYRRYAIQSEQIRQAQLQRQQEQVKL
LKQRKAFIKKIGPIAREVDKSYDLLPSITIAQACLESNYGQSDLSQKYNNLFGVKGTNPN
TSAVMTTKEYVKDKWVTVKARFQIYDSYEASIRAHARLFQNGTTWNHDQYKHVLASKDYK
TQAKALVTDGYATDPDYADKLINLIEQFDLEKYDK

Enzyme Prediction     

No EC number prediction in MGYG000000161_00261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	72	210	3.7e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	9.04e-63	66	215	45	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	4.14e-36	62	215	318	473	amidase domain-containing protein.
smart00047	LYZ2	2.76e-35	65	214	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	2.79e-28	65	214	151	303	1,4-beta-N-acetylmuramoylhydrolase.
pfam01832	Glucosaminidase	2.69e-27	72	210	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ58549.1	7.74e-126	1	215	1	215
ADZ06724.1	7.74e-126	1	215	1	215
QDD70848.1	3.15e-125	1	215	1	215
ATO53565.1	3.15e-125	1	215	1	215
AEA31514.1	3.15e-125	1	215	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.18e-26	67	214	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	4.53e-18	62	214	58	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.40e-13	66	205	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.68e-13	66	205	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	7.17e-13	65	207	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.35e-39	63	215	47	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	3.69e-23	66	214	64	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	6.93e-23	66	214	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	6.33e-22	67	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	6.33e-22	66	214	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998415	0.000124	0.000052	0.000001	0.000000	0.001436

TMHMM  Annotations     

start	end
15	37