CAZyme Information: MGYG000002997_00026

Basic Information

• Species: Lactococcus_A piscium_C
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A piscium_C
• CAZyme ID: MGYG000002997_00026
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000002997_1|CGC1	91742.7	10.1849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002997	1565244	MAG	United States	North America

• Gene Location: Start: 27248; End: 29716 Strand: +

Full Sequence      

MYYSNCREKQRNIQVVVAIVLLIGMFISIKVSASAVNDYIINNNIKPANETLQLGRIYNQ
DPKINGNLNMNYDDGKPKMIIIHEIGVDGGTINGSIDYMVRTQDSAFVHAFVDDSRLITI
ADKSKKSWGSGGYGNRYGIQIEQMRVTSKAAFYKQIATLANWTAQQMVKYDMGAPKLMSS
PSTPQRNDLSTKPDGNLATHKMISYKYNQTTDHVDPDEYWARFGYDINQFRDLVATYYNG
NQVKQNVGYLDTLGITGEGNTIKVRGWHYSPKKYEFLFIMDADTGKEISRQQVSQPEIRN
DVKSVYKYNNAEKSGFNKVLWVPRGKTIYVMSRKTDDPKGNDSGGADDIRFSSNVIKTFS
NRGYLDSVSLNGNTLSMRAWFWAGQSYKYQFVFALDATTGKELSRKAANIETRVDVKRAL
NNLTNSEKSGVKVQLAVPIDKNIKIMIRRTNDPKGNERGGKSDYIFGGKTISSYKSKFNQ
NSLSVAGTTLSTRGWFWTQQATYKYQYIFVMDKNTNQELARKLTPILNRSDVKNYLGNLK
GTNQTGFDTSIKLPGNKQAYIMVRRTNDPKGNGIGGYTEISFPNKVVQTKATLPVKPVKP
SQPAKPSQPVKPSQPAKPSQPVKPSQPAKIDLTGTNDTQKAWFNALYASAQQLAKANDLF
PSVMMSQAIAESAWGQSELAKTGNNLFGVKADPSWTGAVVNRLTLENTTAANQTVTGYRT
EAEGRAGKPATTFVLANKGTPYYIYTGFRKYASQSESLRDYVTKIKTTVNGSTYRYQGAW
RSKAGSYQNAAHALKLGGYATAPDYATNLTNRIEKYKLYVLD

Enzyme Prediction     

No EC number prediction in MGYG000002997_00026.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	648	818	4.7e-28	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.90e-37	633	822	37	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	5.42e-26	650	818	331	468	amidase domain-containing protein.
PRK06347	PRK06347	2.01e-24	587	822	90	303	1,4-beta-N-acetylmuramoylhydrolase.
PRK05684	flgJ	9.34e-23	583	817	106	298	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	4.91e-21	631	818	1	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDJ25195.1	0.0	25	822	1	798
CEN29383.1	0.0	1	822	1	834
QDJ28867.1	0.0	21	822	1	778
QIW53050.1	4.72e-176	25	822	1	656
QIW56712.1	5.29e-175	25	822	1	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KNK_A	4.01e-22	34	238	27	211	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNK_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_A Chain A, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_C Chain C, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_D Chain D, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325]
3LAT_A	1.39e-19	75	238	52	202	Crystalstructure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis],3LAT_B Crystal structure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis]
3FI7_A	2.33e-19	632	818	23	179	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	5.78e-17	629	822	51	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	3.55e-09	663	817	27	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2FZK7	3.31e-19	34	238	223	407	Bifunctional autolysin OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=atl PE=1 SV=1
Q99V41	5.70e-19	34	238	215	399	Bifunctional autolysin OS=Staphylococcus aureus (strain N315) OX=158879 GN=atl PE=1 SV=1
Q931U5	5.70e-19	34	238	215	399	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2
Q6GAG0	5.71e-19	34	238	223	407	Bifunctional autolysin OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=atl PE=3 SV=1
Q5HH31	5.72e-19	34	238	223	407	Bifunctional autolysin OS=Staphylococcus aureus (strain COL) OX=93062 GN=atl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011701	0.987183	0.000436	0.000222	0.000209	0.000219

TMHMM  Annotations     

start	end
13	35