CAZyme Information: MGYG000004234_00251

Basic Information

• Species: Massiliomicrobiota sp002160815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Massiliomicrobiota; Massiliomicrobiota sp002160815
• CAZyme ID: MGYG000004234_00251
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		44915.19	4.733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004234	2339347	MAG	United Kingdom	Europe

• Gene Location: Start: 29521; End: 30636 Strand: -

Full Sequence      

MAFSRFHGDQQYQEFVEKNKSWLYSYAIFRVFKSHHHERSWVEWPEEYKNYQHDQSFSLL
PFTKDIDYQIFLQYFFFLQWQQLRDYAHQKNIEIIGDMPIYVGLDSADVWQNRECFLLEE
DGTPSFVAGVPPDYFSKFGQRWGNPIYNWDYLKQHHYAFWVERMKASQQMYDRVRIDHFR
GFDTYWKIPASEPTAVIGEWVEGPSYDLFDTLYSSIDHLSILAEDLGDLRDEVYQLRDYY
HLKGMYVFQFHYAYDFDFSKVVVYSGTHDNDTLVGWLNTLDEDEYKKLEELLQDYSQKHM
YQKILNYCLDLDAKEVIIPFWDLMGKDTSCRFNVPGKIGSPNWEYHLTDFQEFDVYLEQF
SHMIKESKRGD

Enzyme Prediction     

No EC number prediction in MGYG000004234_00251.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	3	365	2e-107	0.7591093117408907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	1.97e-147	2	370	116	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	1.87e-121	1	348	100	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.16e-101	20	366	165	518	disproportionating enzyme
COG1640	MalQ	1.09e-95	1	365	132	510	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	6.68e-82	10	354	139	498	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN13925.1	2.70e-249	1	371	110	480
APC97523.1	5.68e-135	9	370	124	490
AFB78583.1	1.47e-134	2	367	111	484
AJI69592.1	1.47e-134	2	367	111	484
AKE21428.1	1.47e-134	2	367	111	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X1I_A	1.16e-83	10	347	125	477	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
5CPQ_A	3.25e-82	22	354	205	545	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
2OWC_A	2.10e-81	10	347	128	479	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]
1X1N_A	2.61e-81	21	354	164	505	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
1CWY_A	2.80e-81	10	347	125	477	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P72785	7.55e-86	9	346	128	478	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
Q9LV91	2.37e-81	22	354	217	557	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1
O87172	1.54e-80	10	347	125	477	4-alpha-glucanotransferase OS=Thermus thermophilus OX=274 GN=malQ PE=1 SV=1
P0A3Q0	3.47e-80	10	351	126	477	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	3.47e-80	10	351	126	477	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004234_00251.