CAZyme Information: MGYG000000391_00285

Basic Information

• Species: UBA11475 sp003538975
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA11475; UBA11475 sp003538975
• CAZyme ID: MGYG000000391_00285
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		52169.5	7.7228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000391	1644097	MAG	Sweden	Europe

• Gene Location: Start: 298334; End: 299722 Strand: -

Full Sequence      

MKYVLPEKLISVSGSLNAKTLLKKKEDQNLLTESDLAVFEAGGHIVLDFGKEYAGGIRIL
THFKAGRVRIRFGESLTEANSDIGVSGSTNDHAIRDFETPLAFLSDATLGNTGFRFVRID
FYEETEVKSIYAATVSYNGKPIYEYKGDKDIERIFLTAKRTVDLCASGRYVWDGIKRDRL
VWFGDLHPETIALSSVYGKCQNVENSLNLARKTTPIGEWMNTFPSYSMWWITTVYDYMRL
SGRTEFAKKQLPYMKRLITEFDKNVSDGGEMLFNSYFTDWQTHDTPQEKEGVRAIFIIAV
NSAKKLFGFFGEDTKIADKVLGKLFKKEINTGDKKQIIALKYLATGKLTESDRKTLLTGG
AKGISTFMSYYILTAIASFDKTAAVNIMKEYYGAMINKGATTFWEDFDIDWVKNSCRIDE
TPTDGEKDLHADFGAYCYKGLRHSLCHGWSAGVIAFIKENLS

Enzyme Prediction     

No EC number prediction in MGYG000000391_00285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	42	460	4.5e-51	0.8591269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	0.005	148	461	10	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL50446.1	3.35e-105	3	461	42	518
BBE16159.1	5.57e-105	2	459	41	520
ATP57578.1	2.25e-103	2	461	42	522
QQD16513.1	2.95e-103	3	461	29	506
QGQ98689.1	2.83e-101	3	457	16	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.23e-17	43	454	192	629	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.78e-08	34	459	79	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000391_00285.