CAZyme Information: MGYG000002418_00106

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_00106
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000002418_1|CGC2	82625.99	6.507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 119979; End: 122174 Strand: -

Full Sequence      

MKKSIFLLTCFVFLLLIGQELAGQGQAQWITTERCQSASNTWLAYRKTCTIHHVPDKLLA
KIAADTKYWLWINGKMVVFEGGLKRGRSPHSTYYDVVDIAPYLWENENTIAVLVWHFGKD
GFAHVNSGKAGLLFEAIGEDVTLLSDESWQCTLYDAYQNTGAPYPNYRLAESNIRFDARR
MIADWYKPDFEGSFPGAQLVVAATETFGTLVERSIPQWKNSGLIAYPKVRYSKAGDTLFC
SLPYNAQVTPYLKVEAGEGKTIHILTDNYGGGSELNVRAEYITTNGLQEYESLGWMNGHE
VLYIIPEGVKVLDVKYRETGYNAGLDGAFRCDDPFLNELWKRSARTLYITMRDNYMDCPD
RERAQWWGDEVNELGEAFYALSPEGQKLALKGIYELINWQRADGTLYSPVPAGNWAKELP
LQMLASVGWYGFYTQYYYSGDSSFVSAIYDGLHRYLHEVWKTDDSGLPIERNGGWSWGDW
GENVDMGVLTNCWYYLALKAEHAFAVQLGKISDAEEICRMMNTIEKCFNTKFWTGTEYRA
PGYRGATDDRAQAMAVVSGLASPEKYKPLLKIFKEQYNASPYMEKYVLEALFRMNQPDFA
ILRMKQRYKKMLGYPYSTLFEGWGIGADGFGGGTINHAWSGGPLTILSQQVCGVEPTSPG
FKTFKIAPQLGSLHEAEAVIPTHYGNIEVKIRKNGRTQAFRIKVPEGTVAELLLPGKKTE
ILYPGVHKLNK

Enzyme Prediction     

No EC number prediction in MGYG000002418_00106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	305	713	1.3e-80	0.8234126984126984
CBM67	27	192	1.1e-30	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.18e-23	327	643	4	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.23e-11	653	729	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.002	436	540	352	469	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT54419.1	0.0	26	730	33	739
ABR43077.1	0.0	26	730	32	738
QRO16732.1	0.0	26	730	32	738
QUT95158.1	0.0	26	730	32	738
QUT19199.1	0.0	26	730	32	738

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000190	0.999215	0.000145	0.000148	0.000129	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_00106.