CAZyme Information: MGYG000002788_00138

Basic Information

• Species: UMGS1004 sp900548845
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS1004; UMGS1004 sp900548845
• CAZyme ID: MGYG000002788_00138
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855		97680.59	9.1784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002788	1418375	MAG	United States	North America

• Gene Location: Start: 6214; End: 8781 Strand: -

Full Sequence      

MKAIRLRTEYLKDPLGIDIQKPLLFWNCEGGSKQAAYRILAQTDGKTVWDSGKVASSSMR
AEYPEKLVSRLRVEWKVKLWDESGEGEWSEPAAFEMGLLTPSDWKAVWIAGNYKVNRKKR
YPVDCFQKQFTAIGVQKARLYASACGLYEVRLNGVRVGDMVFAPGSTDYRKRIQYQTYDV
TSLVKGGVNVMTAALADGWYRGSNGPQGRRNSFGTQTKLFVQLELYDSEGKITRICTDGS
WAWSNDGPIRFADLRDGERVDARKSPTYSKKAKPVKCKANLTASDNVLVREHERFFPEEL
IVTPSGKKVLKFPQNLSGYLCFRLSARAGQRIRIRLGEMMKDGEFTQKNIQNIHKGKPTP
LQEIDYLCRDGINEYTPKFFFGGFQYAEVETDIPFEKENFTAIAVYSDLEETASFSCSHP
LINKFFENTRWSLKSNSTDVPTDCPTRERMGWTGDSEVFFNTAAYMTDYAAFARKHVRDV
FDRRWKKGCLPQIAPWSNEDFVIYGLNGSVGWACAGVYIPLYLYDRYGDKRVLEEHYEDI
LDYADFMIRRAGKWGGFYSMPMHLSRENRKYAVNSGRSYGEWAEPANVKPIMWYDFVTSK
PEESTAYTYFTLQRVLRIADILQKPKTKRLARILEYSEGAKRAYRELVTKPKFSLDTDRQ
AKLVRPLYMGLLTVEQEDFAKKRLIQALENYGWRLGTGFLSTPFILFVLEKIGIEYAYKL
LENEELPGWLFMPKHGATTIWEAWEGNVKESAIGAQGGIASLNHYSKGAVCEWLMSEMCG
IKVMGENQFLIAPKPGGSITYAKAEYQSIYGKVACGWEKTKEGYRYTVTLPSNTTARLIL
PDGREKMLSSGTYQL

Enzyme Prediction     

No EC number prediction in MGYG000002788_00138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	303	840	4.3e-127	0.9920634920634921
CBM67	107	266	2e-24	0.8352272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.67e-81	410	774	1	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.36e-45	135	267	3	135	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.29e-17	788	845	11	68	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.78e-14	303	406	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25263.1	0.0	1	855	1	844
QFJ55302.1	0.0	1	855	1	863
QUC03017.1	3.13e-297	1	853	1	878
AWI66986.1	1.72e-278	1	853	7	857
ADP81465.1	3.83e-253	1	854	1	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.28e-110	9	854	10	862	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.78e-103	6	841	35	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.90e-101	1	841	1	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	4.18e-113	8	848	41	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.12e-102	13	841	42	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.72e-100	1	841	1	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	5.66e-77	13	854	42	922	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002788_00138.