CAZyme Information: MGYG000003212_00578

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; HGM11417; HGM11417
• CAZyme ID: MGYG000003212_00578
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883		100947.71	5.367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003212	1992234	MAG	United States	North America

• Gene Location: Start: 1094; End: 3745 Strand: +

Full Sequence      

MPTMILKLKCNYSDEPYPVDSEDILFTATTEGGECDSFLFELMQNGEPVYRRRTEGKIFW
PLRLQNFSLQENTDYTWRVRAFFKDREVADAQRTFVTAFRPRLAKWIADPTANECVSKFR
KEFFVREGCEKAALFICGLGFFEANVNGKQTDRWYFKPLFTDYEARDICKNRSLSAAGEH
TVSAYVFDILPHLNAGRDNFLEVLLGNGYYHNEDKLEEPFVSFGQKKVIFEIRLTYPDGE
EIFYSDEGTKACKTGMLSDLFAGNHLDFTKADTELRPCAAVQNSAGRFIFPRLHADVAQE
ISPVNIRQEQKGMLVDFGLNHTGDLSFKIRGKRGQRLTLHYAETLDADGRINRETGVWEA
YNIQKDEMHRIEQTSVYILSGNVDQIRPLFSWRCYRYVLFENFGDAEIFELKSLFLHTDI
ACDGKFSCSNALFNRICDASVLTMLDNLHCGIISDCPHREKRPYTGDGQIVAEAMFYAFD
SQPLYEKWLADILCAQRKDGFVPYSAPYLGGGGGYAWSLAIAVVPDILYRFTGDKFYIEK
SYRGLYRWIGFCQAHARENIVEDNGERWMLGDWLAPEMSVFNVRLMNTLCYYISVITAMK
VASFLGKHQEEAELSRQSREIADAINREFFDWEKCQYANGVQGENLYPLVLDIVPRECRE
RLIERVQETYTGNNYHLDTGIVMTPILFQALIENGMEEIAYRILDSRSYPSYAKLLEGES
TLPEHWSKKWPDYCINGTSEIVKGGGELSHCHPMFGSVIAVLYKYVAGLDLSYLYRGKVI
VAPRFTQFMEFASAEKETTFGRAAVDWRKKSGLLYLRVTVPSGLEGEIHLPGVHGGYLLT
NEKASHRIMAAGKPVSIQVSAGEWTLLELSESRCEEIVNEAVV

Enzyme Prediction     

No EC number prediction in MGYG000003212_00578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	309	830	5.9e-118	0.9900793650793651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.60e-75	424	766	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.81e-14	314	417	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.88e-13	130	271	4	133	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.22e-09	778	837	11	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99317.1	1.18e-113	7	843	15	849
QBE96295.1	2.24e-110	104	832	124	834
BCJ98018.1	2.97e-110	68	831	84	859
QMW80401.1	3.27e-109	104	832	125	835
QIB56822.1	3.27e-109	104	832	125	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.78e-78	119	831	179	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.21e-45	104	834	285	998	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.30e-47	117	860	185	936	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.78e-47	46	831	108	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.61e-47	120	843	174	891	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.18e-44	104	834	285	998	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003212_00578.