CAZyme Information: MGYG000003249_00166

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_00166
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680		76414.55	5.4396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 2547; End: 4589 Strand: -

Full Sequence      

MESGGYLGGAGNRLVRRSFVIDRPVAEAVLTMRADPVTYSWPAWMEIPNLEHNWLMAGSM
LKFRVQLNGTAAAVGPLRPVCDGSAVEQSFDVTSRLRTGENVIGVVSRGEQYGFWARLTI
RFADGDALVIVGDRQWRSWNANEFYCPVCWWRPQLSARGNFGPGEPGENPDGENFPFGWD
SPGFDDSGWAEAEPTAQADVYPVEPAELEPLELNRLAPVSSFTTADGRRVFDFGRPVCGY
LELTSPEAGTIEVRQGEELLPYGKGGVRFFLRTGNVYQSGWRFPEGGGTLTGFGLRSFRY
VELVGAPVAAVPVAVAVNQPFAAQDGEVMLADERLQRLWRLCKQTIQFTGFDLYIDCPSR
ERMVYEADLYINMLTHFAVEHRTALARRSIRYQMNHYTWPCEWRLFLIPIVREYFWHTGD
LALVAELYERLKTECSFHRLLRNGLVEEFPMRVIVDWPVSCRDEHEFGPNDAVPNAFVYR
DLVDLAELAGFLGKSADQREFSQLAAEVKNAFNRRLFDPEQGLFVDHTGSRHAGFHANVF
ALAFDVAEPENVPQALDFIDRAGMRGSVYTAQFYLDALCRHGRVRRAVELMTDDGPRSWL
RMLADGAGVTTEAWNAELKPNMSLVHPWGSAPGNVIVRWIFGLRPLTPGWIRYAVEPNPG
GIAHGHCRLRTPGGVVESRF

Enzyme Prediction     

No EC number prediction in MGYG000003249_00166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	223	680	1.6e-92	0.9484126984126984
CBM67	51	198	2.9e-19	0.8011363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.40e-35	323	641	1	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.97e-13	88	196	44	154	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
PRK10137	PRK10137	1.75e-04	475	526	581	632	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45611.1	2.97e-283	6	680	3	679
BCJ57454.1	2.63e-106	14	677	344	990
AVT31770.1	7.01e-104	63	680	399	1016
QYJ03013.1	1.57e-103	58	680	359	991
AVT37927.1	9.72e-103	63	680	399	1016

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.24e-23	90	677	232	872	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	2.54e-65	295	680	697	1112	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KPL4	1.52e-14	82	678	232	881	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_00166.