CAZyme Information: MGYG000003504_00111

Basic Information

• Species: CAG-1435 sp003537755
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; CAG-1435; CAG-1435 sp003537755
• CAZyme ID: MGYG000003504_00111
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		84256.69	6.5595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003504	2246614	MAG	Fiji	Oceania

• Gene Location: Start: 2830; End: 5067 Strand: -

Full Sequence      

MKNRRFVRETVDCMIENAKWIAATEAEQAPCIEKKFSVGKVRSAILDITGLGYFYAEING
KKVTDDLFNPVFSDYRARSLNNLLYPIADKMTHRVYFCRYDIAEMLKSGDNVLSVYLGNG
WYRQTKRTAEGHLEFGNKLIARFSLRYVDEQGCEREILSDGTEVWRQTEITDNNIFYGET
QDLRVLVKTPKYGDVTVEDDFETIFTLQTCPAERVIRTIAPRLVKQNGNKRVYDAGETVS
GRVRLRAYGNSGDVVMVNHSECIAKDGTLDVNSSGGDILNDRGEKQLQLMKYVLDGTNRE
LYPKFCKQAFRYFEVEGKAEVVSVEVIHTCLSERTTFRCSNGVLNWLYTAYKRTQLINMH
DGFPSDCPHRERLGYTGDGQITASAAMTMFDCESFYRKWIRDICDCQNIDNGHIQHTAPF
YGGGGGPVGWGGAVVQVPYAFYMHYGDKSLVKEVLPHITEWVDYIISRTDNGLVCREENG
GWCLGDWATSDVVIPQEFVNTTLFVYMLEKAAFLAEQVGNCGLVNKFVELCKQYRKSVTK
AFFDDKTGSFAGGVQGADAFALAAGLGDRRTLDNLVAKYTVNRRFDTGFIGTYVLVEQLL
AHDKVDVAFDLLSTTVKGSFGYLKRLGETTIWEYLDTKWCSHAHPMFGAVAEFLPKVLLG
LPDKERTNEVVLRPRFPRKLSYAEGSALYDGKPVEVRWRKTNNTIRYRVFVANGLNVSVI
CNGKTTVLSEGKNELTIQLLDDENE

Enzyme Prediction     

No EC number prediction in MGYG000003504_00111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	227	719	1.9e-105	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.17e-65	336	658	5	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.61e-29	39	184	1	131	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.72e-10	225	328	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	2.68e-182	18	739	6	726
BCJ98018.1	9.47e-135	20	702	127	839
QOY86540.1	1.92e-108	18	734	132	847
QUT50058.1	1.78e-105	18	720	142	857
AWY99317.1	8.23e-101	17	727	128	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.34e-61	29	711	176	888	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.32e-59	40	700	315	973	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.59e-42	34	665	136	782	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.77e-59	40	700	315	973	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	5.08e-52	29	686	184	871	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	3.00e-37	18	711	151	868	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003504_00111.