CAZyme Information: MGYG000003985_00215

Basic Information

• Species: CAG-873 sp002493945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp002493945
• CAZyme ID: MGYG000003985_00215
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		94352.07	6.3748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003985	2303173	MAG	United Kingdom	Europe

• Gene Location: Start: 5438; End: 7993 Strand: +

Full Sequence      

MKRTIPILLLAAATALPCDAAGRRTQALGNDAWTASQWISATNAPVITGPITGVNERAAD
GASWFMSTVRNDRKVKSAVWMTAGLGVYDLYVNGRLIGDEVLKPGFTHPEKTKRSFTYDV
TDAINRKAGAENTFSVESTPGWWADKIVTPGGHDGMKGRKPAFRGVLQVTYDDGTTRLYG
TNTTDWSAGVAGPITHAAIFDGEAYDSRIRPGHDTPGLLGKPEVNSEFGGDILPSQGAEI
YMRDDLAMQPVKAYVWKGVSGQDGDHFGKVNIIREYTPGKEIQLAPGETLVLDFGQNCAA
VPEFVFSAAEGTRVSAFPSELLNDGNGARSRGMDGPEGSTHRLNLRIPDTGMLMDYTFGT
GKGYATYRPTHTFYGYRFLSVTADGDLRIKAIRSVPVTSIARHLETGTIETGHDMVNRLI
SNTLWGQRSNYLSVPTDCPQRNERLGWTADTQVFAETGTYFANTRDFFHKWMRDMRDSQH
PLGGFPGVAPTAQYGGEPTRLGWSDAGIIVPWVVWKQFADTAIVNENWAAMEKYINHLDE
TNYDHFALMNENGNYQWADWLSYEPLESCSGRMNGPDGILPETHAYWNYLSANYWLMDAE
MMRDMAAATGRDAARFSRMADKARKYIKEKFIDDKGNFTTPILNTMQTPALFALRNNTVE
GEARKAVADRLRENFAEHDNCLRTGFLGTSILMPTLTENGMADIAYELLFQRKNPSWMYS
IDNGATTIWERWNSYMLDTGMGPQGMNSFNHYAYGVVCEWMWESMAGIAADTSAPGFSRI
IMKPVPDRRLGYVKAEYKSAAGTVKSHWKYDGDTWTWKFTVPKGATALVTVPGDTSAKEY
AAGSYTVTRKI

Enzyme Prediction     

No EC number prediction in MGYG000003985_00215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	285	830	2.8e-140	0.9880952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.86e-105	405	765	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.17e-26	74	218	2	142	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.23e-13	773	835	5	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.50e-08	282	382	1	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR48396.1	0.0	2	849	11	868
QIX65068.1	0.0	2	849	11	868
BBK93107.1	0.0	2	849	11	868
QUT20979.1	0.0	2	849	3	860
QJE29828.1	0.0	2	849	11	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	5.38e-111	73	834	314	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.59e-84	71	838	141	853	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.67e-71	62	832	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.31e-110	73	834	314	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.66e-104	28	836	144	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.53e-97	28	836	141	883	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.17e-52	33	811	146	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000459	0.998397	0.000403	0.000258	0.000234	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003985_00215.