CAZyme Information: MGYG000004469_00061

Basic Information

• Species: Alistipes_A sp900545315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900545315
• CAZyme ID: MGYG000004469_00061
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		80398.33	6.3066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004469	2457179	MAG	Israel	Asia

• Gene Location: Start: 79375; End: 81504 Strand: -

Full Sequence      

MTTRTRLATWATLLVLGGLSLTTVQAANNDKRPEQQPASAVDPLYSHTVVTPAPDTVAGA
PWLYADTELEAWRLQLMRQLVIDARLRVRYPGEYYTPSNRTHFRIPMPVDARYPQFITLN
AFGDVTVEVNGQKIYTAANSDKPHKFKVVNPGLLLITLTTDKEPPTLRIDKGVIATDNPH
WEASSDSITWAAACHYPQYKNGTLPHRFDTPTVRLQPVSSQNDTLYDFGRQLLGFIVIKA
ESQPEFFAGESILEAVDTAARPREQSFDLEQIGKGVWRSVTPVAFRYAYLPQKGLIQSVE
CDAYAYPACYRGDFQSSDTLLTDIWFKSAYTLRLCMHEFLLDGVKRDRLPWAGDLAMSMM
VNAYTFRNPEIVRRTLAILGRAGIANEDINGIADYSLWWVISQDRYQLYFGDMEHLRREW
PRIKALLKEVESRCDENGLFTEGLDWLFIDWTNIEKENALQVLWWWAQESAVSLANRMND
PQTAAYWQDKADNLKKVLYERGYDPVRKAWRGKPDGQSQPNRHANFLAVISGLAHPSQYP
GILDVLADTTVTAVGTPYMAGFEYMALSRMRAPERMLREMKDYWGGMIAQGATSFWEGYD
VREDSVTQYSFYRRPFGKSLCHAWSSGPAALIPSELLGIRPISDGWKVFEIDPQVPLSMQ
PLKATIPTQYGDINVTMENNRLRVTIPEGTTGKFQGKSYTASTPLDVQL

Enzyme Prediction     

No EC number prediction in MGYG000004469_00061.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	221	693	3.1e-89	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.82e-21	312	633	4	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	6.83e-07	350	644	284	615	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	1.47e-06	638	693	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG53178.1	0.0	1	709	1	724
AVM44883.1	2.38e-126	42	671	15	621
QKJ20518.1	3.52e-101	52	709	37	696
QTX05357.1	4.89e-94	54	696	28	673
SDT18190.1	2.06e-90	62	690	38	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.01e-73	90	689	46	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	2.31e-35	201	699	418	954	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.61e-32	218	632	89	538	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000789	0.997963	0.000312	0.000365	0.000273	0.000243

TMHMM  Annotations     

start	end
7	26