CAZyme Information: MGYG000004833_00517

Basic Information

• Species: UBA5446 sp900752445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp900752445
• CAZyme ID: MGYG000004833_00517
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695		77681.25	5.2973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004833	2201859	MAG	Sweden	Europe

• Gene Location: Start: 16815; End: 18902 Strand: -

Full Sequence      

MGDFVLAPGVTDYRKRVQYQTYDVASLLREGENELTVQLADGWYRGSCGAWGLRNQYGTQ
TRLLARLELTGADGFVRSVASGPDWDWSNDGPIRFADIQDGEVIDARMAPSYSGRARVTK
HPAAPTASDNVPVTEHERLRASLITTPSGKKVLDFGQNIAGYVRFSLDAKAGQRVFLRFG
ELIGEDGEFTQKNIQCATKKRATPLQQVEYICKTGKNEYKTTFAIFGFQYVQVETDVPFA
LEDFEAIAVSSDMERTGWFESSNELLNKFFENTVWSAKNNHADLPTDCPTRERHGWTGDA
QLFCGTAAYIFDYAAMARKYERDLTDGQHKNGCFPQIVPVGGTDFYMKVMDGSAGWSDAG
VFIPWEIYRRYGDRAILEENYDAMRAYTRFKLRTLGRWYPTARPTGVHGMAKRWVSNYGQ
SYGEWAEPAEIRPFSTSDFVVPHPEETTAYVALLLDRMSGIAAALGRDGEAAEYAKDAGN
VRLGYQALVETERHGLDTDRQAKLVRPLCLGLLSERQREYAQRRLIKALDGYGWRLGTGF
LSTPMILYVLADMDIEYAYRLLENEEIPGWLSMPKNGATTIWESWEGPNAQGGVASLDHY
SKGAACQWLFECMCGINLAGENRFVIAPRPGGRFTRASAEYLSVYGMVKSGWVRSEGKTE
FTVTVPANCTALVRLPDGGEREQGPGTQSYTIEEA

Enzyme Prediction     

No EC number prediction in MGYG000004833_00517.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	145	675	8.6e-137	0.9940476190476191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.90e-93	254	613	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.82e-38	2	137	26	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.91e-17	144	250	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.43e-14	619	687	7	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25263.1	2.09e-316	1	686	153	840
QFJ55302.1	1.75e-289	1	687	164	860
QUC03017.1	1.52e-280	1	694	191	884
ADP81465.1	4.88e-221	6	691	165	861
AWI66986.1	4.47e-208	1	692	166	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.86e-110	6	676	343	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.15e-96	1	692	166	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	4.78e-77	1	681	211	904	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	8.01e-110	6	676	343	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.12e-90	1	691	209	894	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.01e-79	6	671	211	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	8.12e-55	1	675	219	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000039	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004833_00517.