CAZyme Information: MGYG000001289_00038

Basic Information

• Species: Streptococcus sp900543065
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900543065
• CAZyme ID: MGYG000001289_00038
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001289_1|CGC1	42382.11	8.7002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001289	1985520	MAG	Italy	Europe

• Gene Location: Start: 38296; End: 39399 Strand: +

Full Sequence      

MKTKKMRYVWFLAILCIFCLTLFLARTRSKVDMRNRIYRQWQDHFVVSKGKESYVQTNNS
KDQTVVLSEAQSYGMVITVAAAKKGQAQQEDFERLYQYYLNHRITDTQLMSWKQTIVDGK
ASAEDHNATDGDLYIAYSLLEAAQQWPKQAKKYQDQAKAILEDVLKYNYNEETGVLTVGN
WANQDSNFYYLMRTSDTLPAQFQLFYKVTNDSKWLDIKDKMLHQLDVVSSKTSSGLLPDF
IWVDHDGASVADPNTIESKYDGSYSYNACRLPYNLSQSKDKTSQKLLKKMLGFFKKQRNL
YAGYDLKGKALNDHQAASFLAPIVYASESGEGYLKLVQQNKYIFTQDLPLNNYYDATMTT
MIALELF

Enzyme Prediction     

No EC number prediction in MGYG000001289_00038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	364	8.9e-70	0.98125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3405	BcsZ	6.39e-20	5	314	1	296	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	5.31e-18	38	364	8	317	Glycosyl hydrolases family 8.
PRK11097	PRK11097	2.15e-09	51	270	32	248	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB39088.1	1.66e-269	1	367	1	367
AEH56684.1	4.27e-224	1	367	1	367
AFJ25304.1	1.43e-222	1	367	1	367
AGY40742.1	2.42e-200	1	367	1	367
AGY37425.1	2.42e-200	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	2.21e-33	27	322	54	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	6.59e-22	68	337	73	350	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	7.26e-22	68	337	79	356	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	1.34e-09	35	361	2	308	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.21e-32	27	322	54	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	5.75e-22	68	326	129	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.890290	0.085081	0.022760	0.000305	0.000210	0.001352

TMHMM  Annotations     

start	end
7	25