CAZyme Information: MGYG000001335_00180

Basic Information

• Species: Lactobacillus ultunensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus ultunensis
• CAZyme ID: MGYG000001335_00180
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		28772.21	10.2697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001335	2168092	Isolate	not provided	not provided

• Gene Location: Start: 93973; End: 94707 Strand: -

Full Sequence      

MKRRKYLSLYIVTVVAIFVAIMAYVRFDNSREVRRSFYLHWQRYYVVEMKSDEKYVNTTP
HTDKKVALSEGQGYGMYIAALAAERKWGHQKDFEQLNNFYLKHRDTVNKKKTMLMSWRAI
EKKGKWSIDKNSATDGDLFIAQALLLASKQWKNKKYKNEATALLADILHYEYNARTKTLT
VGDWANSKSKYYNLMRTSDVMPEFFDNFYQATGDGRWLIIKKTMLKRLNELSHLHKSGLV
PDFA

Enzyme Prediction     

No EC number prediction in MGYG000001335_00180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	40	244	2.4e-51	0.6

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3405	BcsZ	6.50e-18	51	171	38	151	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	9.63e-17	39	244	6	201	Glycosyl hydrolases family 8.
PRK11097	PRK11097	3.84e-11	60	171	45	152	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ06292.1	8.63e-121	1	244	4	247
AFR21164.1	1.28e-119	1	244	1	244
QAU31989.1	1.28e-119	1	244	1	244
QPB50941.1	1.28e-119	1	244	1	244
AZK91867.1	1.28e-119	1	244	1	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.74e-21	28	244	59	269	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.05e-17	35	244	32	246	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.11e-17	35	244	38	252	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	6.89e-13	69	217	33	174	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
5GY3_A	1.61e-10	41	170	4	122	ChainA, Glucanase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.26e-19	41	244	69	269	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	7.81e-17	28	244	81	302	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P18336	9.50e-11	41	170	27	145	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P37696	7.43e-10	69	243	56	222	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	1.46e-09	60	244	45	222	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.893012	0.095279	0.005750	0.000709	0.000361	0.004902

TMHMM  Annotations     

start	end
7	25