CAZyme Information: MGYG000002579_00311

Basic Information

• Species: Ligilactobacillus sp900765635
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus sp900765635
• CAZyme ID: MGYG000002579_00311
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
991	MGYG000002579_3|CGC3	108063.19	5.2765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002579	1757018	MAG	China	Asia

• Gene Location: Start: 39296; End: 42271 Strand: -

Full Sequence      

MQNKKTHYKMYKSGKKWVFMGITTVSLVTVLGATTHPAKADNVNHSTPSVLATKNTDQTV
SIQSSLDAVNKELANKIIVLLKENNISFNQISIGTADDQTTSDLVGQLNGNSVNNLKDNG
YLIKSGTINNQTALAIQGKDATGLFYALNQVITTINDKQSVTNLAVYESPQMSIRGVIEG
FYGQPWSNQARKDMFKFMGQHRMNTYIYSPKDDTYLRENWRKPYPQDKLNEIKELVDEAK
KNHVEFVYALSPGNDITYSSTADYQATIAKFDQLRSIGVSQFYIALDDINPVINDTDAAV
FPAHDTPNYPNNSWSPLADAQAYYLNKVQREYVEKNNLPALWLVPTNYSGSAQDPFKEAQ
GLALDKDIHIQWTGEGVFSDKITADSINKAKETYHTDKLFIWDNFPVNDSNQDRLYLNPV
VGRADDLYQTTEGFTSNPMIEPYASWIGIGSYADYMWNSSTYNPQTSLNNVLAEIAGNDS
TVLDSLKAFADLNQYWDHGSADEQTKAPILSSLVTAYQKSSPGSDLHAQALANLKAQLTK
IAQASVTLQHLAIPGFYNDALPWINAASHWAKASLANIEITEALQSANPVNLDTLGSNLV
TLKSEIAQAKVKAIVDGRTDSSEPAIVPSVGDGVFETLTNLNGDFNNLDSWFGFTPLKVT
NNKYTGTASTQIPVYQNNGVANITDDSDTSLFWSSRNTAKGDTITLKLTKPQQIASIVLK
QGDTDTATSGDMFTDATVYIGNKEDGSDKQAVGHIASSGLAQVDLSTPVTGQYVFIVANS
DSSSWLKIRDLSVYGTSNFKLTNSSSSDGKSIQTLFDGSLTTDFTAKINDTSKSATIEQV
SDTPVTNANSLVLVGKAKGTLYVRSNGTWQKVGKTDGSKQINEFGLTNSQSKNKAATGFD
GIRLVLDPGSQNVVLSELNFSTKTAPVYSEDTNKNPETPSDKPTNTNKNTNKNTNTKKDG
NLPQTGEQVSILASLAGLFLAGLAVLGFKKH

Enzyme Prediction     

EC	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	175	490	7e-99	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.39e-140	175	489	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
TIGR03715	KxYKxGKxW	2.61e-09	5	27	1	23	KxYKxGKxW signal peptide. This model describes a novel form of signal peptide that occurs as an N-terminal domain with a recognizable motif, reminiscent of the YSIRK and PEP-CTERM forms of signal peptide. This domain tends to occur on long, low-complexity (usually Serine-rich and heavily glycosylated) proteins of the Firmicutes, and (as with YSIRK) the majority of these proteins have the LPXTG cell wall-anchoring motif at the C-terminus.
pfam00754	F5_F8_type_C	2.50e-05	667	785	3	119	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
TIGR01167	LPXTG_anchor	3.43e-04	962	990	2	30	LPXTG-motif cell wall anchor domain. This model describes the LPXTG motif-containing region found at the C-terminus of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall. Hits that do not lie at the C-terminus or are not found in Gram-positive bacteria are probably false-positive. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region. [Cell envelope, Other]
pfam00746	Gram_pos_anchor	0.003	962	991	9	39	LPXTG cell wall anchor motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APU72174.1	1.66e-249	81	733	143	792
QGH68398.1	7.31e-184	91	918	117	912
AER06669.1	8.07e-181	68	918	63	886
ALD69353.1	1.84e-180	68	918	92	915
QJW35068.1	3.68e-175	93	918	111	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	1.72e-65	91	582	100	576	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2CBI_A	2.02e-63	63	612	46	584	Structureof the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
5OXD_A	3.47e-63	63	612	48	586	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	3.77e-63	63	612	46	584	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
4ZXL_A	1.32e-62	63	612	38	576	CpOGAD298N in complex with Drosophila HCF -derived Thr-O-GlcNAc peptide [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XL08	4.48e-61	63	612	76	614	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	2.64e-60	63	612	76	614	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q89ZI2	1.77e-51	130	463	107	419	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
O60502	1.82e-38	176	512	63	375	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
Q8VIJ5	1.82e-38	176	512	63	375	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000868	0.998170	0.000374	0.000226	0.000173	0.000155

TMHMM  Annotations     

start	end
17	36
969	988