CAZyme Information: MGYG000001378_00074

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00074
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718	MGYG000001378_1|CGC3	83739.67	4.7957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 90471; End: 92627 Strand: -

Full Sequence      

MIHTIIKYLLISATLFFCSCHKPKTDIITPAKQLIERQIGERAQSIHFEYIEPSDGKDIF
EVIASDGRLTLRGSSSVAICYAFHTYMKEACKSMKTWSGEHITSVMPWPDYELYEQVSPY
ELRYFLNVCTFGYTTPYWDWERWEKEIDRMALYGVNMPLATVASEAIAERVWLRMGLNKE
EIREFFTAPAHLPWHRMGNLNKWDGPLSDAWQQNQIALQHQILTRMRELGMQPIAPAFAG
FVPEGFVQKHPDTQFRHMRWGGFDEEYNAYVLPPDSPFFEEIGKLFVEEWEKEFGENTYY
LSDSFNEMELPIDKEDKEAKYKLLAEYGETIYKSITAGNPDAVWVTQGWTFGYQHSFWDK
ESLKALLSNVPDDKMIIIDLGNDYPKWVWNTEQTWKVHDGFYGKKWIFSYVPNFGGKNTM
TGDLDMYASSSVKALRAANKGNLIGFGSAPEGLENNEVVYELLADMGWSSDSIDLDDWMK
IYCEARYGGYPDAMEEAWKLFRKTAYSSLYSYPRFTWQTVIPDQRRISKIDLSDDYLQAI
RLYASCADELKNSELYRNDLIEFVSYYVAAKAEIFYKQALKDDSENRVLAAQRNLQQTVD
LLMDVDRLLASHPLYRLEEWVELARNSGTTLQEKDAYEANAKRLITSWGGIQEDYAARFW
SGLIKDYYIPRIQLYFTKDRNKIREWEEQWITSPWSNSTTPFDDPVKAALNLIEKTNK

Enzyme Prediction     

No EC number prediction in MGYG000001378_00074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	66	714	3.7e-212	0.995475113122172

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	3.83e-173	123	470	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.69e-47	478	709	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	9.30e-26	29	109	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
smart01041	BRO1	3.19e-04	516	634	185	308	BRO1-like domain. This domain is found in a number proteins including Rhophilin and BRO1. It is known to have a role in endosomal targeting. ESCRT-III subunit Snf7 binds to a conserved hydrophobic patch in the BRO1 domain that is required for protein complex formation and for the protein-sorting function of BRO1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72324.1	0.0	1	718	1	718
QUR45704.1	0.0	1	718	1	718
QUT26062.1	0.0	1	718	1	718
QDH53248.1	0.0	1	718	1	718
QQR16072.1	0.0	1	718	1	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	6.29e-121	68	675	51	655	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	6.54e-83	32	671	175	816	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.43e-83	32	671	183	824	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.56e-82	32	671	198	839	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	8.88e-120	68	675	74	678	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.60e-119	31	708	49	789	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_00074.