CAZyme Information: MGYG000001633_00008

Basic Information

• Species: RC9 sp000435075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000435075
• CAZyme ID: MGYG000001633_00008
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	MGYG000001633_1|CGC1	97074.33	5.2335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001633	2721018	MAG	China	Asia

• Gene Location: Start: 13659; End: 16208 Strand: -

Full Sequence      

MIFSKLKLMCAVGAVFLCVSASAAQKDDFKAAEKAASGVITRTLGRKPSNVKLVVTGPLE
GGEYFSTEVRKGKLTVKGSSAVAVCRGFYDYVTSNHYGLSTWTVNNIDLPEKLDDQPLKL
ETTPFALRQYMNVCTLGYTMPYWKWEDWEKELDRMALHGVNMPLSPIGSEAIFARVWKKL
GLTDEEIGKFVTGPAYLPWFRMGNMSELDGNLSESWYEKTIALEHKMIDRMNDLGMTPIF
NAFAGFVPEGIKRVYPDANLIHTGWDDGPYYVSNFISPETELFQLIAKTYIQEWEKEFGK
GKYYLADSFNEMKVPFAERGTKERYNQISNYGKSLYQSIANANPDAIWVLQGWMFGYQRH
IWDPESIEALFSEVPDDKMLLLDLSVDFNYGIWENEYTWNYAKGIYGKPWIYSTVPNFGG
RTAPAGALDFYLNGHLNALSSPNMGNLVGFGTAPEGVESNEVIYEILSDAWWSTSHKDIH
EWLKNYTLNRYGKCPESMMTFWNKMLESSYGMCSSRAQYVVQRQPFYGLGGRYVVSKAHF
EALEAYIAAASELGDNEAYLTDLALWAGFYAFGKADLLVNQINEAYLAGDNEKAAEMEVR
FKDLMLRADRLLDKNPVTRVQRWIDFARSWGDSQQESDKYEEDSRRIVTTWGISYPDAGL
NDYGCKIWSGLIRDYYIPRWQHFFDAKKEGKPFDYVAWEGNFAKEKKLSDFVPVKDLVKE
SQDLVKVAKDIEPLEGQGLSGWTSFEMRDSSTLIIRMMAPEDYIPVKALRFRWKRGEDNV
ILKRVQVNAAGWVRSVKKDINVEIGKDNPVVEIPLEYKRDRTYQFIYVHIELAGTKLNAD
SQVAIEYVK

Enzyme Prediction     

No EC number prediction in MGYG000001633_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	71	724	6.6e-187	0.9924585218702866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.77e-162	128	474	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.06e-63	482	722	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	2.44e-19	34	113	1	80	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23473.1	3.69e-237	61	759	52	748
VEH15977.1	2.59e-229	39	731	36	721
QWO92760.1	4.08e-217	34	791	31	790
QWP70100.1	4.08e-217	34	791	31	790
QWO85452.1	4.08e-217	34	791	31	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.95e-107	73	701	51	677	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	2.36e-80	39	730	177	875	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.67e-80	39	730	185	883	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.28e-79	39	730	200	898	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	2.54e-107	11	701	9	700	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	7.47e-91	33	698	46	766	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002938	0.961927	0.034191	0.000301	0.000300	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001633_00008.