CAZyme Information: MGYG000002584_00026

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_00026
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		95384.36	7.8776

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 31091; End: 33655 Strand: +

Full Sequence      

MSYSLLTSCFLAASAVTPVIASAAAVPASVSALIARTTPQLAKQFKLQIDPSMNGFRITP
STGGFVSITAGNVNELTAGYGYYLRHVLGVHWSWNGNRMDIPNKAIMPQTPIEVKSPWKW
RYAYNYCTLSYTMGFWGPKEWQAEIDRMALNGVNIALVQAGLEKVWQLTLRDLGYPEDKI
RAFIPNPSAAAWWNMGNLEGMSGPISQDVIDREAQLGKAIVSAMESYGMTPVLQGFVGLV
PHDLEQYLHGKDAHYIPQGEWCGQTRPIVLDPTCPAFAKVASIWYKNLQKVYGISPKALG
GDLFHEGGNSGGVDIQNAATAVQKSMHASCPQSIWLLQAWGGNPRKELMDGLNQKYVLVL
ALDRDMSSPFREGSTNAYKNAPWIWTELLNFGGNHGLYGSLKKIASLGAMQQFANKDNLQ
GLGLISEGVETNPMYYEFFFQRLWSPKEQVQTADEISSWMKTYAQNRYGSAPEPVLKGLQ
LLERSVYSPQRMQEGCTESILCARPGRNVQKASTWSSGQIYYNTEDVINAAAAYLQAARE
NPELLRQETFRYDLIDILRQMISDMARPLLAEAMQAYDSGDKKEFEAKASLFLDLINNTD
QLLGTYPQWRFGQMYERAIAKGRTPEEKNNMAMACKRLVTTWSGHIDGLNDYSHRQLAGL
MKDFYGKRWQLFFDSYRQGLEGKLDKKAVDGDFRTRDHAFELGWEKQPASYSSKPEGNLA
QIAQQVFDKFEKPARQLAKSYSKLHNAPKWTLKDGATTLTFDVSDIITAPGTYKATFLWK
SGNSALEISKVTLYEGSKIVAVDEHPGWTGIENKRNTYTLPVEKLRTNLDSYTIKAEVKG
ASGTDSSGVFIFDN

Enzyme Prediction     

No EC number prediction in MGYG000002584_00026.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	64	728	3.4e-185	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	2.20e-118	121	446	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.61e-62	459	724	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	7.66e-16	33	102	6	77	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP71243.1	1.02e-271	25	851	22	846
QWO86637.1	1.02e-271	25	851	22	846
QWO93908.1	1.02e-271	25	851	22	846
QWO96475.1	1.02e-271	25	851	22	846
QWO90734.1	1.02e-271	25	851	22	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.94e-111	44	727	189	877	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.31e-111	44	727	197	885	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.35e-110	44	727	212	900	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	8.10e-81	28	730	7	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	7.06e-80	28	730	30	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	4.86e-67	75	730	104	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.112638	0.886010	0.000345	0.000390	0.000296	0.000276

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_00026.