CAZyme Information: MGYG000000325_00081

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95
• CAZyme ID: MGYG000000325_00081
• CAZy Family: GH9
• CAZyme Description: Cellodextrinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		60967.44	4.4846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000325	3194566	MAG	Sweden	Europe

• Gene Location: Start: 85434; End: 87080 Strand: -

Full Sequence      

MGIFIDQTGYLPASRKVATTTFPCNFQLIDSKTQHAVYDGVSMDSGMDESAGEHVYQLDF
SEATTPGSYYVLAGNGERSHTFIIGDHVYEQLQLDLMKCLYFQRCGCALTSEYAGEYTHA
ACHTEDAIFLEDYMNQTPNPPHFDMTGGWHDAGDFGRYISPAAVAVGHLLYAYELFPESF
QASLHIPESGNLLPDILNECLYELKWMLKMQADNGGVYHKLTSFVHADFLMPEEDKLPFL
IYPVSTMATADFAASMALASRVYAPFDKAFSTQALEASRKAFAYMESHPYIGFHNPEGSN
TGEYDDDCDIDERLWASAELLRTDTAHRDTYLKAFEKYSSMTHPEVSKTDLGWTDVSGMA
TLCLLTDPGNTCGATRKREYEQILFTEADRLIELQKKSGFELSMQPEDFVWGSNMVVCNR
SMLLILASLCSEGDTASRYREAALNQLHYLLGRNALDISYVTGEGEHAFRNPHNRPTACD
GIDLPMPGWVSGGPFKTPCDPAAIAAVPAGTAPMKCYVDDVGSYSTNEITIYWNSPAVFM
TAFFNRTI

Enzyme Prediction     

EC	3.2.1.4	3.2.1.6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	89	542	7.5e-102	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	5.20e-91	95	540	5	373	Glycosyl hydrolase family 9.
cd02850	E_set_Cellulase_N	3.02e-21	3	84	2	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	1.98e-19	3	79	3	83	Cellulase N-terminal ig-like domain.
PLN03009	PLN03009	1.72e-13	144	544	71	488	cellulase
PLN00119	PLN00119	1.24e-12	142	494	72	455	endoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61951.1	5.95e-157	4	546	5	556
QCT02660.1	2.38e-149	2	546	8	541
CQR55153.1	2.45e-146	3	545	9	540
AIQ68376.1	3.47e-146	3	545	9	540
QQZ59400.1	2.78e-145	3	545	9	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EZ8_A	9.09e-97	3	542	9	529	CrystalStructure of endoglucanase Cel9A from the thermoacidophilic Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius subsp. acidocaldarius],3GZK_A Structure of A. Acidocaldarius Cellulase CelA [Alicyclobacillus acidocaldarius subsp. acidocaldarius],3H2W_A Structure of A. acidocaldarius cellulase CelA in complex with cellobiose [Alicyclobacillus acidocaldarius subsp. acidocaldarius],3H3K_A Structure of A. acidocaldarius cellulase CelA in complex with cellotetraose [Alicyclobacillus acidocaldarius subsp. acidocaldarius],3RX5_A structure of AaCel9A in complex with cellotriose-like isofagomine [Alicyclobacillus acidocaldarius subsp. acidocaldarius],3RX7_A Structure of AaCel9A in complex with cellotetraose-like isofagomine [Alicyclobacillus acidocaldarius subsp. acidocaldarius],3RX8_A structure of AaCel9A in complex with cellobiose-like isofagomine [Alicyclobacillus acidocaldarius subsp. acidocaldarius]
5E2J_A	3.41e-95	3	542	32	552	Crystalstructure of single mutant thermostable endoglucanase (D468A) from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius subsp. acidocaldarius],5E2J_B Crystal structure of single mutant thermostable endoglucanase (D468A) from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius subsp. acidocaldarius]
5U2O_A	7.74e-91	26	540	20	535	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
3X17_A	4.14e-89	3	544	18	556	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
4CJ0_A	1.17e-87	3	544	30	547	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23658	5.84e-130	3	539	4	540	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
P0C2S4	6.41e-87	3	544	30	547	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	1.13e-86	3	544	54	571	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1
P0C2S1	2.57e-76	5	546	216	813	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1
P14090	6.61e-76	5	535	343	898	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000325_00081.