CAZyme Information: MGYG000002351_00115

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_00115
• CAZy Family: GH90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697	MGYG000002351_1|CGC4	76136.97	5.4055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 113157; End: 115250 Strand: +

Full Sequence      

MTNITESPSWEDEISLIARSERVSGGQDGAANRPLKSLANRTRFLKEATDSAVLELSGKV
EAVKSFTEGAELLSPRDEILYGNLRLVWTGVFPKVVPADATPYTTGGVGPGRWAYTSDAA
VRQDMASFRTPGTSMLTHSDGKTAEQHIDDLNREKLSFHGATTDGMLAFLAYAAASGREC
IIDGEVNLTEELNFDAHFANIHLRWEAPVNSDTQLFNLHNLGPKSILKDMWFQNITAPWV
INRWDTDGNWIDNAEAIVNSVVQTNEEVGYQPTASDKDVWPLLSDTIKNQEICGGPVIHT
SRGVTVLNPRGRYIAITFMDCNFCKVIEPSVMGGKHQYGTILFNNTGTTAWGKGNKVIDG
EVRYGSVSGVVYMRHKGKSSRISGTNAYRCGESGFKTYQNEVNGRSARCYGMKWDNLTAE
QCYFDGFDLASDYGDAAQRVDDYTLAQFAWNLLPLKHETTNLTAIGCHGTGAWGDGQGST
YRNLHIEDCYSSGTNFIGRYNIIEDVFSKNNNRKNATIADLVAQVKVPGQNNKVSRVTVI
VDDAAITGGYGLYAPSSMVTDLDTDWCTFPSLPSFSERSKMSLGSYSSTETQVWIDGHPR
GAFLKNAIGRLLFELTLGTSGSERGNATLQPVFNGSFTNGLRVRGENGGMAIMAVPTQGN
AAYLDNGTVMFYESSGELKLQFKDSSGAVTTYKLTAG

Enzyme Prediction     

No EC number prediction in MGYG000002351_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH90	178	515	1.3e-59	0.6206896551724138

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18668	Tail_spike_N	6.92e-22	56	118	6	70	Tail spike TSP1/Gp66 receptor binding N-terminal domain. Bacteriophages recognize and bind to their hosts with the help of receptor-binding proteins (RBPs) that emanate from the phage particle in the form of fibers or tailspikes. RBPs of podovirus G7C tailspikes gp63.1 and gp66 are essential for infection of its natural host bacterium E. coli 4s. Gp63.1 and gp66 form a stable complex, in which the N-terminal part of gp66 serves as an attachment site for gp63.1 and anchors the gp63.1-gp66 complex to the G7C tail. The two N-terminal domains show 70% sequence identity to the N-terminal region of the CBA120 phage tailspike 1 (orf210, TSP1). The N-terminal domain of TSP1 is the virion head binding domain that interfaces with the phage baseplate. The N-terminal domain can be further divided into two subdomains, each beginning with a alpha-helix followed by an anti-parallel beta-sandwich. Subdomain two folds similarly to the chitin binding domain of Chitinase from Bacillus circulans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AID87619.1	0.0	1	697	11	707
AID90826.1	0.0	1	697	11	707
QLK22127.1	0.0	94	697	142	754
QLT88663.1	0.0	132	697	2	567
QQQ24468.1	0.0	132	697	2	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RIQ_A	7.73e-62	173	562	27	407	ChainA, Tailspike protein [Salmonella phage 9NA]
2V5I_A	4.25e-45	181	478	41	343	ChainA, SALMONELLA TYPHIMURIUM DB7155 BACTERIOPHAGE DET7 TAILSPIKE [Bacteriophage sp.]
1QA2_A	3.99e-39	173	514	25	371	ChainA, TAILSPIKE PROTEIN [Lederbergvirus P22]
1QA3_A	5.40e-39	173	514	25	371	ChainA, TAILSPIKE PROTEIN [Lederbergvirus P22]
1TYU_A	1.34e-38	173	514	25	371	ChainA, Tailspike Protein [Salmonella phage P22],1TYV_A Chain A, Tailspike Protein [Salmonella phage P22],1TYW_A Chain A, Tailspike Protein [Salmonella phage P22],1TYX_A Chain A, Tailspike Protein [Salmonella phage P22]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P12528	2.27e-37	173	514	138	484	Tail spike protein OS=Salmonella phage P22 OX=10754 GN=9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_00115.