CAZyme Information: MGYG000000184_00022

Basic Information

• Species: Blautia_A luti
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A luti
• CAZyme ID: MGYG000000184_00022
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
899	MGYG000000184_1|CGC1	101349.44	5.7657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000184	3628099	Isolate	China	Asia

• Gene Location: Start: 25578; End: 28277 Strand: -

Full Sequence      

MKHIKFIDNHGSFCVNRPENTSYLYFPLASEAGLKSSVTPVLGGDSKIDQDTFLLEPVSS
ENLHNNRSSRNFWIVKEGHAPYSTTGASAQQEANRFTSRQEDSELTAGFMWQTLKRTSRE
LGLTSTVTSFIPKSDNVELMYVAVENQTDAAQKFTAYGAIPVYGRSADNIRDHRNVTSML
HRIETTEHGINVCPTMSFDERGHQPNHKIYYVNGCSGKGESPISYYPTVEDFIGEGGTYT
HPRAVYEGYKGLPAHSLAAGKEAMGAFCFSSFTLAPGEKTDFILLSGIADSKEEIENIFE
KYNTSDKVKNALEETRIYWKKQVNVDFHTQDPDFDSYMKWVSFQPFLRRLFGCSFLPHHD
YGRGGRGWRDLWQDCLSLLLMNPQNVGAMIEKNYGGVRIDGTNATIIGDGDGNFIADRNG
IARVWMDHALWPLITTSLYINQTGDIEILKKQVPYFKDAQTMRGAEIDTLWNDAYGNKQR
TEDGQVYTGSVLEHILIQQLAAFYDVGVHNIYRLRGADWNDALDMAAENGESVAFTCAYA
GNLHTLASILRLMESAGETSIPLSEEIEILLNDQTDMFDSVSEKKKILTEYAKSCRHNLS
GRKKNFSLSTLAANLIQKSNWLTDHIRSQEWIDGKDSEEGWYNSYYDNHGEAVEGFHHEQ
VRMMLTGQVFSIMGNVATDAQIRKIVKSADHYLYRKEIGGYRLNTDFQELKFDMGRMFGF
AYGEKENGAVFSHMAVMYANALYQRGFAKEGWKALRSLSDTALDFDTSHIYPGIPEYFRS
DGRGMYHYLTGAASWYLFTMITEVFGVRGVSGNLLIHPKLLAEQFDESGTASVSVTFAGK
QFHVTYRNTDRKDYGSYHIAAADCDKTAIEIAEDSHIMISREFINNLSSDLHEITVTLA

Enzyme Prediction     

EC	2.4.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	117	860	3.7e-158	0.6196911196911197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11749	GH94N_LBP_like	2.05e-131	72	298	1	229	N-terminal-like domain of Paenibacillus sp. YM-1 Laminaribiose Phosphorylase and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes bacterial laminaribiose phosphorylase. This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Bacterial laminaribiose phosphorylase phosphorolyzes laminaribiose into alpha-glucose 1-phosphate and glucose, but does not phosphorolyze other glucobioses; it slightly phosphorolyzed laminaritriose and higher laminarioligosaccharides. The GH64N domain, as represented by this model, is also found at the N-terminus of GH94 members with uncharacterized specificities.
COG3459	COG3459	4.03e-47	67	850	320	1021	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.24e-24	318	808	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11746	GH94N_like	2.19e-13	86	288	4	179	N-terminal domain of glycoside hydrolase family 94 and related domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-), amongst other members. Their N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. This GH64N domain also occurs in tandem repeat arrangements (not at the N-terminus) in cyclic beta 1-2 glucan synthetase and related proteins, and as a standalone domain in distantly related proteins of unknown function.
cd11754	GH94N_CBP_like	1.13e-09	117	314	107	303	N-terminal domain of cellobiose phosphorylase (CBP) and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cellobiose phosphorylase (EC:2.4.1.20) or cellobiose:phosphate alpha-D-glucosyltransferase, or CepA. This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Cellobiose phosphorylase participates in the degradation of cellulose, it catalyzes the phosphate dependent hydrolysis of cellobiose into alpha-D-glucose-1-phosphate and D-glucose, a reversible reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTS90962.1	0.0	1	899	1	899
VED93131.1	0.0	1	899	1	899
QGX44464.1	0.0	1	899	1	899
QGX45995.1	0.0	1	899	1	899
QIM46196.1	0.0	1	898	1	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GGY_A	1.10e-294	5	898	9	908	Paenibacillussp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GGY_B Paenibacillus sp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GH2_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH2_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH3_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1],6GH3_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1]
3QDE_A	1.94e-21	122	855	112	779	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3RRS_A	2.41e-15	117	820	107	761	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3S4C_A	1.25e-14	117	820	107	761	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
5NZ7_A	2.28e-09	222	824	374	947	ChainA, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ7_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_A Chain A, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	3.12e-17	122	848	113	774	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	1.28e-14	222	853	220	760	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
Q9F8X1	7.06e-12	122	848	115	763	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000184_00022.