CAZyme Information: MGYG000002307_00026

Basic Information

• Species: Campylobacter hyointestinalis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter hyointestinalis
• CAZyme ID: MGYG000002307_00026
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		60720.47	7.9731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002307	1753385	Isolate	Belgium	Europe

• Gene Location: Start: 30106; End: 31680 Strand: +

Full Sequence      

MDNLLIVIPAIKKNAVIPDQLIKKLDGITLIQRAINTALDMVNNKNIFIITDSQEISLIS
ERNGIEYYLDPNLKLNSGNILELTLNTTKKFSHTNILLYRANTPLVGSDILLNAYNEFKK
DISYMLVSIKINEKKLLKLDNGFLHSVDDGIYFNELKSFYIFNKYNLDVKKSKPFIIKQE
KSIEILSYQDWWVCEKILKRKKIIFNVIGNIEIGMGHIYHSLALAHEITDHEIIFVCDEK
YKIAVDKLASSDYKVISTPNILNTIIQIKPNLVINDILNTEYKYIRCLKNCGIKVVNFED
LGDGSHFADIVFNELYDKPIFNDKNFRWGYNYLALRDEFYEAVPHDILEDIREVLITFGG
ADQNNLTLIALKSIINKCKKLNIKINIVCGEAYRFKNELHDYISKVSYKNIYLTYASEVI
SKIMEKSQLAISSNGRTVYELADMNIPSIVISHHERENTHSFARPERGFINLGVINESIE
KKIKDKFDKLVDDIDYRKLLFLNIKEYNFRDNKQKVVKEILSLI

Enzyme Prediction     

No EC number prediction in MGYG000002307_00026.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3980	SpsG	7.53e-27	202	457	2	258	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd02513	CMP-NeuAc_Synthase	4.16e-07	5	198	3	223	CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety. CMP-N-acetylneuraminic acid synthetase (CMP-NeuAc synthetase) or acylneuraminate cytidylyltransferase catalyzes the transfer the CMP moiety of CTP to the anomeric hydroxyl group of NeuAc in the presence of Mg++. It is the second to last step in the sialylation of the oligosaccharide component of glycoconjugates by providing the activated sugar-nucleotide cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), the substrate for sialyltransferases. Eukaryotic CMP-NeuAc synthetases are predominantly located in the nucleus. The activated CMP-Neu5Ac diffuses from the nucleus into the cytoplasm.
COG1083	NeuA	5.09e-07	5	202	5	226	CMP-N-acetylneuraminic acid synthetase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	8.73e-06	215	519	10	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE31748.1	0.0	1	524	1	524
QKF54913.1	0.0	1	524	1	524
ALV23648.1	0.0	1	524	1	524
SNB47013.1	4.26e-155	1	524	1	537
ABM29645.1	3.45e-123	6	524	8	535

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58462	1.15e-27	209	455	9	272	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002307_00026.