CAZyme Information: MGYG000002930_00074

Basic Information

• Species: Prevotellamassilia sp900540885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900540885
• CAZyme ID: MGYG000002930_00074
• CAZy Family: GT0
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		68634.86	5.379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002930	2680968	MAG	Mongolia	Asia

• Gene Location: Start: 74512; End: 76323 Strand: +

Full Sequence      

MRIAYISNNNPRDINNWSGTPYHIISALSKYHEVDWVGGGTLHGALWHHRFLNNKKPFNL
LDYNEDIGHVVSNFVKDGKYDIAISSTYSMCSFLDIDIPLIAFSDLTYNLCTTYLKRAPD
ELKEQAMQIEKDFLQLADAIIYPSSFAKDAAMADYNIEENKIHILDFGANIPTPVGVKVD
EFESDICKLVFIGRNWVKKGGNKALATYSLLKTQGFPCELTIIGCEPPYKVEDSDVKVFP
WLDKSNADDLLLYDKIMRESHFLILPTEFDAYGIVFCEASAYGIPSLAPNVGGVSQPIRE
GLNGYLLSSHASASDYAEKIKTIFQDKEKYRTLRLTSRNEYDTRLNWDIWTKSMNTIMDN
VVRDKQIKRVENNYGIIEKVENEKGAEADSFYIPVYAFNLKSRPDRLAHLQHQFEDKPEF
KVTHITAIKHDIGAIGLWESICKAVAMAQKQNEDIIVLCEDDHEFTQYYSVDYLLSNIAE
AYAQGAELLNGGIGGFGNAVPVDTNRSCVDWFWCTQFVVLFAPIFSKILNYDFKEGDTAD
GVLSHIADSPQVMYPPISTQKDFGYSDIIQRQPMFQNRLFYSCNKRLASIHSVYQKYLRG
SKY

Enzyme Prediction     

No EC number prediction in MGYG000002930_00074.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	9.23e-33	2	354	1	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.35e-19	1	365	1	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	2.73e-14	129	349	132	356	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd01635	Glycosyltransferase_GTB-type	1.53e-11	162	307	85	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03811	GT4_GT28_WabH-like	1.78e-11	74	340	78	342	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB69923.1	2.13e-202	1	593	1	580
QUB60703.1	6.06e-202	1	593	1	580
QUB82181.1	6.95e-201	1	593	1	580
BCA48826.1	4.09e-174	1	590	1	574
ALJ43352.1	2.33e-173	1	590	1	574

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48453	6.65e-08	111	308	111	308	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q5YP47	1.10e-06	255	335	312	391	D-inositol 3-phosphate glycosyltransferase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=mshA PE=3 SV=1
A0JZ09	1.37e-06	189	326	228	371	D-inositol 3-phosphate glycosyltransferase OS=Arthrobacter sp. (strain FB24) OX=290399 GN=mshA PE=3 SV=1
A1R8N8	3.08e-06	176	326	214	365	D-inositol 3-phosphate glycosyltransferase OS=Paenarthrobacter aurescens (strain TC1) OX=290340 GN=mshA PE=3 SV=1
D1BD84	7.33e-06	118	348	150	404	D-inositol 3-phosphate glycosyltransferase OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) OX=446469 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002930_00074.