CAZyme Information: MGYG000001692_00188

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_00188
• CAZy Family: GT1
• CAZyme Description: 4'-demethylrebeccamycin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		45702.8	5.4368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 163144; End: 164427 Strand: +

Full Sequence      

MATILLAATATPGHVNPMLAAARLLVAQGHRVLMLCGALFEQRIRATGAEFVPFAPEVDF
DYRALERHFPERASLSGTAQMALALKRFFAAPMAQHDSHLRALIAAEGVELLLVENGFYG
VLPLLQQPHGRPVPILMLGVNPVSYSSPDAIFYGPRIPPELRRSLGELPWLDEPTRQLQR
EVQQRFDAALAEAGAPPLTAPFTDVMVTAPDAFLQLSCAGFEYERPELEGVIRYVGPLLP
PRLELTPPPWWERLDERPLVIVSQGTLANVDLGQLLLPAIQGLAGDELQLLLTTGGRDPA
LLGDAIPANAIVTDHVPFELALPRAAALVTNGGYGSVQSALAHGVPLVVAGTGEDKAEVA
TRVAWSGAGINLHSNEPTAAMVATAVRKVVREPRYRARARLLAEEMAALDGRAAIAGTVA
DLLGGRP

Enzyme Prediction     

No EC number prediction in MGYG000001692_00188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	12	422	1.4e-42	0.9869109947643979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	1.56e-47	1	427	1	403	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	4.90e-42	4	422	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	2.31e-34	13	414	7	383	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam00201	UDPGT	4.94e-09	184	402	199	418	UDP-glucoronosyl and UDP-glucosyl transferase.
pfam03033	Glyco_transf_28	0.005	4	57	1	56	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKG00693.1	3.82e-294	1	426	1	426
AHV34192.1	6.33e-293	1	427	1	427
QSR42423.1	1.22e-290	1	427	1	427
ASX10967.1	4.97e-290	1	427	1	427
QSR54930.1	1.66e-288	1	427	1	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	4.87e-12	4	411	23	395	CrystalStructure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
2YJN_A	1.68e-11	141	426	151	437	Structureof the glycosyltransferase EryCIII from the erythromycin biosynthetic pathway, in complex with its activating partner, EryCII [Saccharopolyspora erythraea NRRL 2338]
3RSC_A	8.62e-11	2	398	21	387	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	8.65e-11	2	398	21	387	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
4M83_A	7.64e-07	10	411	16	386	Ensemblerefinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KHE4	6.90e-67	2	410	3	408	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
E7CQW6	8.49e-38	13	395	19	407	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
J4VV61	7.53e-36	8	410	25	448	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
E9L011	1.26e-35	13	406	17	414	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
P9WFR0	2.09e-14	233	404	242	407	PGL/p-HBAD biosynthesis glycosyltransferase MT3034 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3034 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996031	0.003965	0.000027	0.000007	0.000004	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_00188.