CAZyme Information: MGYG000000008_00176

Basic Information

• Species: Lactobacillus johnsonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus johnsonii
• CAZyme ID: MGYG000000008_00176
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000000008_1|CGC1	45915.35	6.1431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000008	1971706	Isolate	United Kingdom	Europe

• Gene Location: Start: 173047; End: 174231 Strand: -

Full Sequence      

MAHKNLIRRLPNIHFNIVSGRALYTGLDILTQNGNATLYPQILNYQLKSIIEKTDLCFDI
GYGNKNVHFETVLKLLDIPTFAFRDTQYHEQSNNYYVADSMDEMIKQVNKLPANSSKKSF
DDIFDISVKSIDETLDEIIENKKSVVRIGDGELDLIYGEDIIYQHFNPELAKILKDSILN
NHNPRVLTCLPDIFTNLDRYNEMRGYYAVGVLPRFSDFFKEIEKTKYSYGSTFMSRMYMS
FKDKSKSQHYFHKLRKIWQNKDILIVEGEYTRSGVGNDLFENVRSIQRIICPAEDAYDEV
HEIEEAIRNNAQNKLILLMLGPTAKVIVNDLQDLDNQILDIGHIDTKYEWFKMDAKYVVS
IGKNKHMAESVDKNLNEEDNPQYQKEIIMKINKK

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	145	369	1.2e-87	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	3.92e-151	128	392	1	265	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
pfam08759	GT-D	8.13e-116	146	369	1	222	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOG26109.1	1.54e-290	1	394	1	394
AAS09482.1	1.54e-290	1	394	1	394
QMT67763.1	1.54e-290	1	394	1	394
QTQ39651.1	2.79e-270	4	391	280	667
QIA88041.1	1.49e-233	4	394	238	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5V4A_A	1.79e-79	126	388	6	268	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]
4PFX_A	2.51e-71	125	391	11	276	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	2.51e-71	125	391	11	276	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	8.81e-69	125	391	11	276	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	9.15e-82	6	388	298	676	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	3.17e-78	6	391	429	812	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000008_00176.