CAZyme Information: MGYG000000634_00790

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; SFHR01
• CAZyme ID: MGYG000000634_00790
• CAZy Family: GT104
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		36495.37	8.8411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000634	1737692	MAG	Madagascar	Africa

• Gene Location: Start: 17374; End: 18318 Strand: -

Full Sequence      

MNAFIFCKVIDNFGDAGFALRLSREFCLKFSLKVILRINRPDLIVKMLGDENLPNFQLLP
WDSQTFALQNGDIVIELFSCHLPDFALKEIEKTTANFAWFAMDYLGLEKWILDCHLKPSP
QKNKTKYFYFPSFLKKGGGIINEKSELPSPFDLKKPWKINVFLYDESPIQFLKNQNLHFL
GKNAFLPQKKFDAKLDSATLNLIRGEDSFVRSILAGQPFVWQAYRQKDNAHFQKVLSFLE
IFSPFLDSKIRQHVCDFFYFLNAMHTDFSAESLLSPETFTIWQQNSHAFAQTLLAEKSLP
KTLIDFVKSKKIWS

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT104	2	145	6.1e-28	0.40633245382585753

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10093	DUF2331	1.34e-59	5	308	3	373	Uncharacterized protein conserved in bacteria (DUF2331). Members of this family of hypothetical bacterial proteins have no known function.
COG4394	EarP	2.08e-44	5	307	6	365	Elongation-Factor P (EF-P) rhamnosyltransferase EarP [Translation, ribosomal structure and biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZA76585.1	3.96e-48	5	310	6	376
AGF48187.1	6.44e-43	1	311	1	361
QKJ67058.1	1.11e-41	5	310	6	375
BBL33826.1	1.49e-41	5	310	5	375
AGF48887.1	3.59e-41	1	311	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J7M_A	5.04e-30	5	263	25	348	Complexstructure of the Pseudomonas aeruginosa rhamnosyltransferase EarP with the acceptor elongation factor EF-P [Pseudomonas aeruginosa PAO1],6J7M_C Complex structure of the Pseudomonas aeruginosa rhamnosyltransferase EarP with the acceptor elongation factor EF-P [Pseudomonas aeruginosa PAO1]
6J7L_A	5.64e-30	5	263	25	348	Crystalstructure of Pseudomonas aeruginosa Earp in complex with TDP [Pseudomonas aeruginosa PAO1]
6J7J_A	2.85e-29	5	263	25	348	Crystalstructure of Pseudomonas aeruginosa Earp [Pseudomonas aeruginosa PAO1],6J7K_A Crystal structure of Pseudomonas aeruginosa Earp in complex with TDP-Rha [Pseudomonas aeruginosa PAO1]
5WXI_A	4.07e-29	5	312	10	381	EarPbound with dTDP-rhamnose (soaked) [Neisseria meningitidis H44/76],5WXI_B EarP bound with dTDP-rhamnose (soaked) [Neisseria meningitidis H44/76],5WXJ_A Apo EarP [Neisseria meningitidis H44/76],5WXJ_B Apo EarP [Neisseria meningitidis H44/76],5WXK_A EarP bound with domain I of EF-P [Neisseria meningitidis H44/76]
5NV8_A	6.31e-29	5	239	20	319	Structuralbasis for EarP-mediated arginine glycosylation of translation elongation factor EF-P [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9HZZ1	2.08e-29	5	263	6	329	Protein-arginine rhamnosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=earP PE=1 SV=1
E6MVV9	2.23e-28	5	312	10	381	Protein-arginine rhamnosyltransferase OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) OX=909420 GN=earP PE=1 SV=1
Q88LS1	2.86e-28	5	239	7	306	Protein-arginine rhamnosyltransferase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=earP PE=1 SV=1
A0A0T7AQA7	5.70e-27	5	312	10	381	Protein-arginine rhamnosyltransferase OS=Neisseria meningitidis OX=487 GN=earP PE=1 SV=1
Q8EEP8	7.74e-24	5	242	12	326	Protein-arginine rhamnosyltransferase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=earP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000634_00790.