CAZyme Information: MGYG000000874_00424

Basic Information

• Species: CAG-267 sp900551865
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-267; CAG-267 sp900551865
• CAZyme ID: MGYG000000874_00424
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000000874_3|CGC1	35824.82	9.228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000874	1307174	MAG	United States	North America

• Gene Location: Start: 59432; End: 60358 Strand: -

Full Sequence      

MAVSHQESKYSAQVSPNKPLRIVRLGGGLGNQMFQYAFGLAAGNVLWDNTGFLTNHYRSF
DLGLYSISGDFASDEQIKRCKNEIRFKNILPRSIRKKFNLGKFIYLKTNRVCEKQINRYE
PELLSKEGDVYYDGVFQTEKYFKPLRERLLHDFTLTKTLDAANLDMLAKIRAANAVAVHI
RRGDYLNPRSPFTYLDKDYFLNAMDYIGKRVDKPHFFIFSSDTDWVRANIQTAYPQTIVE
INDEKHGYFDLELMRNCRHNIIANSTFSWWGAWLNTNPDKIVVAPKQWFKPDAAEYSGDI
VPEDWIKL

Enzyme Prediction     

No EC number prediction in MGYG000000874_00424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	22	308	4.2e-75	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	4.82e-58	22	289	3	256	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	8.19e-25	27	293	8	281	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK64917.1	6.04e-66	22	308	3	289
AYR22730.1	1.36e-65	22	308	3	293
QOT78612.1	7.44e-65	22	308	3	292
QUN31569.1	1.67e-63	22	308	3	292
BBC24666.1	2.82e-62	22	308	3	294

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	6.56e-31	25	308	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q10980	2.19e-11	141	302	174	359	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Fut1 PE=2 SV=2
O09160	2.96e-11	141	302	175	360	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mus musculus OX=10090 GN=Fut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000874_00424.