CAZyme Information: MGYG000003678_00328

Basic Information

• Species: CAG-95 sp900553305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp900553305
• CAZyme ID: MGYG000003678_00328
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000003678_52|CGC1	30573.56	6.5947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003678	2408138	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 46; End: 825 Strand: +

Full Sequence      

MSFYHTKQTLRKFELGIFKLPLQVADQREICRLKGYTNDASRIQKAFTTRIYKHPCIYTE
DLDKGYQDMVLQKDSVYLSGYWQNECYFKEIRNRILEDFTFPQEVTDRKQDMVRQMKGSN
SVSVHVRRGDYLQSGNAGIYGGICTLTYYRKAMDYMREHIQNPQFYIFTDDPEWVKQNLY
EDGMCLVQHEGGDPDYLDMYLMSQCTAHIIANSTFSWWGAWLDRSERKTVVSPARWLNNH
DVNNAICDWFITIESQVAG

Enzyme Prediction     

No EC number prediction in MGYG000003678_00328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	47	244	1.8e-67	0.7101449275362319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.80e-58	75	244	88	263	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.97e-24	77	230	125	271	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	8.45e-07	81	228	130	286	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	6.33e-05	81	227	35	204	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK64917.1	4.40e-55	9	238	42	272
QUO20851.1	1.23e-50	13	235	46	264
AMR31835.1	1.24e-50	6	241	45	279
AKF24141.1	2.89e-50	10	243	43	279
APC05322.1	4.31e-50	1	243	35	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	4.32e-27	73	253	117	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866D6	5.27e-15	78	222	164	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Leontopithecus chrysomelas OX=57374 GN=FUT1 PE=3 SV=1
Q866E8	9.83e-15	78	222	165	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866F0	9.83e-15	78	222	165	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1
Q866F1	9.83e-15	78	222	165	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003678_00328.