CAZyme Information: MGYG000002433_00184

Basic Information

• Species: Campylobacter_A concisus_P
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_P
• CAZyme ID: MGYG000002433_00184
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38576.23	8.2967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002433	1923750	Isolate	Denmark	Europe

• Gene Location: Start: 18357; End: 19391 Strand: -

Full Sequence      

MKILVSALEPSANLHLKEILKNFEGEFELMGIFSEEFGTPYMKSSEFSAMGFVEVLPLIL
KAKKAMKVMSQMAKEADAVLLIDSPAFNLPLAKAIKEAGVKAAVTYYILPQVWAWKPKRV
SAVEKYCDNLASILPFDSKFYGRSTYVGHPLMDEIRLKKTSLSSSGKVAFLPGSRRSEIS
RLMPVYRELAKKIEARRLLVVPPFLLDKVGEIYGDTSDFEIVSNTPEALYDSDFAFICSG
TATLEAALIGTPFVLAYKAKAIDVFIARKFVKIKHAGLANIMFDFMGKEPLHEEFIQEFA
TVDNLLKAYECCDRQKFLKGCDELREYLSHGSSKNVVKILKNME

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	312	1.9e-88	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	343	2	347	lipid-A-disaccharide synthase.
COG0763	LpxB	1.81e-101	1	333	2	367	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.59e-82	3	332	1	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK00025	lpxB	7.83e-82	1	339	2	370	lipid-A-disaccharide synthase; Reviewed
TIGR00215	lpxB	5.91e-74	3	334	8	377	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF48101.1	2.22e-235	1	344	1	344
QPH84958.1	2.59e-234	1	344	1	344
QPH93352.1	5.23e-234	1	344	1	344
QPI03422.1	7.44e-234	1	344	1	344
QPH88474.1	7.44e-234	1	344	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.40e-22	77	308	92	340	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.40e-22	77	308	92	340	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	1.21e-130	4	343	5	364	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	1.21e-130	4	343	5	364	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	4.90e-130	4	343	5	364	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
Q17WJ2	1.20e-96	3	336	4	349	Lipid-A-disaccharide synthase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=lpxB PE=3 SV=1
B5Z7M7	4.80e-96	3	336	4	349	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002433_00184.