CAZyme Information: MGYG000002820_00543

Basic Information

• Species: Negativicoccus sp900556745
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Negativicoccaceae; Negativicoccus; Negativicoccus sp900556745
• CAZyme ID: MGYG000002820_00543
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173	MGYG000002820_23|CGC1	18987.91	4.514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002820	883065	MAG	United States	North America

• Gene Location: Start: 11024; End: 11545 Strand: -

Full Sequence      

MLTAAELLAKEFPLQCWLPRASTISEAELAPLLAETELDIQMTTSHLHDLMTVCDAALAA
SGTVTLETALLGLPTVLCYKVAPLTYWLGRRVLQTPHIGLPNIVAGREVIPEFLQQDVTP
ENLAHAVASWWRDEEASRRLRDDLAMVREKLGAPGAVGRVADLIIRIAEENND

Enzyme Prediction     

No EC number prediction in MGYG000002820_00543.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	151	1.4e-43	0.4180790960451977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.42e-56	1	171	207	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.48e-48	4	170	212	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.78e-32	4	126	209	334	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	2.90e-18	55	126	237	312	lipid-A-disaccharide synthase.
PRK01021	lpxB	1.41e-12	48	127	483	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV60281.1	1.57e-45	1	170	206	376
SNU95574.1	8.64e-45	6	170	212	376
ACZ24221.1	8.64e-45	6	170	212	376
QQB16511.1	8.64e-45	6	170	212	376
CAB1276542.1	1.22e-44	6	170	212	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.49e-18	2	169	213	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.49e-18	2	169	213	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	5.48e-40	1	167	212	379	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	4.10e-39	1	171	212	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	6.64e-37	1	167	212	379	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q3JAC1	7.78e-35	1	172	211	382	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q3A550	9.17e-33	3	170	217	384	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002820_00543.