CAZyme Information: MGYG000000010_00006

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_00006
• CAZy Family: GT2
• CAZyme Description: 4,4'-diaponeurosporenoate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42837.09	9.8492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 4699; End: 5844 Strand: -

Full Sequence      

MIVINYFISLMIVIWSMISGKLMFLYRRLIDVNQMTAETPPISIIIPARNEQSNLPKLLK
SINANNTRTEVIVVDDDSTDDTRGIAEACGAKAIQVSGHSKYKGKSNACWQGALQASHSF
LLFIDADVELTAKESLSRIYGQYEKQSCKGLLSIQPYHMIKNKYENLSAIFNLFTLVGMN
AFSYKHHNNKNIGAFGPVVFTNKQDYLTTEGHLNAQGAIIEGFAISKAYDKLGLPVEIYE
GANIVNFRMYPEGLSSLVNGWSKHFASGSSITKRSVMFMTMSWLFGSITSVLLIIFGLKK
SMKALIISLIMYGSYALQFLILIKRVGNFNKVISLLHPVFSLCFVIIHAKSWMDIHVFKT
VKWKDRKIDLNAKLESRGEKE

Enzyme Prediction     

No EC number prediction in MGYG000000010_00006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	43	157	3.8e-20	0.6882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	2.58e-06	44	127	1	92	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	3.01e-06	44	130	1	90	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02522	GT_2_like_a	2.21e-05	42	130	1	85	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	3.82e-05	1	347	14	369	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	1.36e-04	43	145	1	105	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU09684.1	1.22e-269	1	381	1	381
QRA16796.1	6.03e-128	6	370	4	367
QQY19653.1	8.54e-128	6	370	4	367
QKQ09233.1	1.21e-127	6	370	4	367
QKQ02000.1	1.21e-127	6	370	4	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3F1Y_A	2.41e-06	42	127	96	189	Mannosyl-3-phosphoglyceratesynthase from Rubrobacter xylanophilus [synthetic construct],3F1Y_C Mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus [synthetic construct],3KIA_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus [synthetic construct],3KIA_C Crystal structure of mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus [synthetic construct],3O3P_A Crystal structure of R. xylanophilus MpgS in complex with GDP-Mannose [Rubrobacter xylanophilus],3O3P_B Crystal structure of R. xylanophilus MpgS in complex with GDP-Mannose [Rubrobacter xylanophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GDN6	7.14e-90	12	371	11	372	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=crtQ PE=3 SV=1
Q7A3E0	1.43e-89	12	371	11	372	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=crtQ PE=1 SV=1
Q2FDU4	1.43e-89	12	371	11	372	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=crtQ PE=3 SV=1
Q6G6B1	1.43e-89	12	371	11	372	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=crtQ PE=3 SV=1
Q5HCY7	1.43e-89	12	371	11	372	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=crtQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999412	0.000609	0.000008	0.000003	0.000001	0.000005

TMHMM  Annotations     

start	end
4	26
167	184
276	298
305	322
332	349