CAZyme Information: MGYG000001194_00584

Basic Information

• Species: QAMH01 sp003149935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; QAMH01; QAMH01 sp003149935
• CAZyme ID: MGYG000001194_00584
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812		93161.37	5.0237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001194	2060639	MAG	Austria	Europe

• Gene Location: Start: 33624; End: 36062 Strand: +

Full Sequence      

MKLGTITRGDRKIYILLTADCPQGGSIVAESHCQGDDAVPALVAAKDAAHGEYVLILPLL
YVEQTVTVRVLDAEGTVLDEESQKVRHLSSALTAKYNTLSKAPGVNDIRNFDRYARNDIS
HIEPDRICYYGYEPQNSELVHIVITTHCDDESTYQTPFEVIVFDRQGKRMPIRNHAVLSD
KLDHPVPHSDFTRRTIHTSFLKDHGNDWFFIWVRFENDALPPAFICMDKWRTEYIRDRFQ
KKFNDSGQGPFYEDWFYHTQKKAPMELDGQRRAHFEIEPLFSIIVPLYKTPLDFFAEMSQ
SVLEQTYGKFELILVNSTPEDKELAAAVAACAANDDRVRVVTLDKNYGIAGNTNEGIAIA
QGDFLCFFDHDDILEPSILFEYVDAINRYPETDLLYCDEDKIRDGKLFDGFLKTDFSWEL
LATCNYVCHLLTVRKSIVDVIELSGDEVTGAQDWDMTLKVAEKARNIFHVRKVLYHWRSH
EHSAASNANAKPYTHKAGEIAVRNHYERIGIPVDVLDGFCGNMHRIVYHLPEKKPLVSII
IPNKDQSFMLERCLDSIWEKTTYENFEIIIVENNSVEDETFALYERLQAEHGNLRVVRFE
DSFNYSAICNLGVTHAVGDHYLFLNNDMEVITPDWIELLLGPLQREEVAVVGARLLYPDR
TIQHDGVVIPRSDPKHVACMAPASLVYYFGMIHNARDVLAVTGACLMVSRKDFESIEGFD
ERYAVAYNDVDFCLRLVEKGRHIIIDPNIELYHYESVSRGFDETVESKMRNAEELAMFQK
RWPRFIAEGDPYYGTNIAHANAYYALNWDVRA

Enzyme Prediction     

No EC number prediction in MGYG000001194_00584.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	282	391	1.4e-22	0.6352941176470588
GT2	538	660	2e-22	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.17e-70	279	478	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.24e-38	539	755	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.06e-28	535	786	3	252	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.32e-19	538	713	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	1.16e-17	536	754	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL42361.1	2.62e-187	39	811	323	1090
BCB69517.1	2.62e-187	39	811	323	1090
QOL46489.1	3.15e-185	39	811	323	1090
AZH69456.1	1.46e-181	6	806	23	823
ATP53720.1	2.07e-181	6	806	23	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.48e-07	280	379	6	102	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.99e-100	279	798	366	889	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.37e-80	273	797	313	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	6.04e-13	279	627	13	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q58457	1.48e-09	278	459	7	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	5.25e-09	280	422	4	145	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000034	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001194_00584.