CAZyme Information: MGYG000001418_00033

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_00033
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923		97529.62	5.8908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 34740; End: 37511 Strand: -

Full Sequence      

MFDEPDDPRAWLEDPPTVAAVLVAHDGMAWLPTVLGSIATMEHAPTAWHAVDVASTDGSG
DLLRASFGDERLSYAPSGTGFGAAVDLAVEQLPRTDWIWLLHDDSAVEPDTLARLLDEAT
TAGDDVAVVGPKLREWPSLRRLLEVGVTVSGTAHRETGLETGEPDAGQHDRPRDVLAVSS
AGMLVRRDAWDALGGFSADFPMFGDDLDLGWRAARAGYRVRVAPPAVLFHAEATARRARP
RSTGDVSPHEERRAMLFLTLAHATGRRAALAWWRLLVGSFLRTLGLLLAQAPEEAGDELQ
ALRDVYLHPRSVRRARAERAAAETVPHARLRHLFPSPWLPYLRALDTVREWAAALLRPES
MVTTGRRSSVLDPEPDDVPDDGPSLWRRRPWLLTVLLVLAVVGVASRDLLSGPYLHGGAM
LPAPRTAGGWWELFLSGGHDVGLGTSGSGPVLALLLAVVATPVWLAPGLVTSVLVLGAVP
LAALTAHRFVRLFTDRRGLRILAALGYAAAVAASGAVAEGRVGTLVTAVVAPIAAGVAVR
LWFEPRWQRGVALGVWVAVATAFAPVAFWLALPLALALALRRTRPFLVAAALAVVLPLVL
VGPWTWQRVVAPARVWWEAGLPLPADASAIDVALGRGSDAGAPLGLVAPVLLLAVVALLA
VPARERRAVVVAWSAALVALAVAVVGLFSSVDTGTGAATAAAWTGLPALLWVGALLVACL
LAAEAVGPLRVALTVPVVLLALVLPLGTAAWLVVHGAGDPLERDRDTPVPAYLADRDATT
LVLTGTLDGPMQVDVVRGAGPFLGQETLRPDAERQDALLTTVEALVAGTGAAQVSELADL
GVDAVYLPDADRALAQRLDALPDLRAAGSDDPASRVWTLEGATPPSADGSWWRTVVAVVL
AVAWLVAVVLTAPVRRRRKEVLR

Enzyme Prediction     

No EC number prediction in MGYG000001418_00033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	18	233	9.3e-17	0.9130434782608695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	8.59e-30	21	230	2	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.14e-28	16	243	3	232	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	8.58e-15	20	233	1	175	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	9.51e-14	96	257	77	230	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam13641	Glyco_tranf_2_3	5.39e-12	15	234	1	215	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXT85727.1	3.12e-290	1	917	29	945
QGG42196.1	2.38e-279	9	917	10	916
AWB93025.1	9.48e-270	9	917	37	944
QNL93894.1	8.45e-219	10	918	13	923
SKB08396.1	2.52e-211	3	916	4	921

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	3.30e-12	21	272	8	274	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.30e-12	21	272	8	274	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
Q50864	1.40e-06	98	238	659	800	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P64868	3.49e-06	52	230	34	198	Uncharacterized protein Mb1552 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=wbbL2 PE=4 SV=1
P9WLV2	3.49e-06	52	230	34	198	Uncharacterized protein MT1576 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL2 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
463	485
498	517
521	543
550	572
587	606
613	635
640	662
669	691
701	723
732	754
891	913