CAZyme Information: MGYG000001598_00417

Basic Information

• Species: Lawsonibacter sp900553135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Lawsonibacter; Lawsonibacter sp900553135
• CAZyme ID: MGYG000001598_00417
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		41763.23	5.5046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001598	2409533	MAG	China	Asia

• Gene Location: Start: 27211; End: 28290 Strand: -

Full Sequence      

MKVCVYAICKNEAQFVRRWMDSMGEADQIVVLDTGSTDDTVKLLRERGAQVTREEITPWR
FDTARNRSLELVPQDVDICVCTDLDEVFHPGWRRALEAAWRPGTGQARYRYTWSFNPDGS
EGVVFWYEKIHARRGYRWVHPVHEVLEWVGEGEPGPFVRVEGVQLDHHPDPSKSRAQYLE
LLELSVREAPQDDRNLHYLGREYLFRGRWEECICTLKAHLALPSATWRDERAASMRYLGC
AYEQLGETGEAESWYLRAIAEAPHLREPWVDLAMLCYRREDWEGVRWFTGRALAIEKRPE
TYICQAQAWGSLPWDLRALALYHTGELEQALAAARKALELEPGNARLRDNVRLMEKLET

Enzyme Prediction     

No EC number prediction in MGYG000001598_00417.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	3.72e-14	2	169	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	3.92e-09	232	339	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0463	WcaA	2.55e-08	1	99	3	107	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	4.87e-08	196	283	4	86	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR02917	PEP_TPR_lipo	5.36e-08	198	345	95	227	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA29496.1	5.33e-176	1	351	1	351
ANU42689.1	1.53e-175	1	351	1	351
QQR04409.1	1.53e-175	1	351	1	351
AQS58818.1	9.36e-146	1	355	4	357
CAB1239995.1	4.68e-145	2	356	5	358

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XC90	3.78e-07	2	96	4	95	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001598_00417.