CAZyme Information: MGYG000001742_00140

Basic Information

• Species: Dysosmobacter sp900752075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900752075
• CAZyme ID: MGYG000001742_00140
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		53183.55	8.5018

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001742	2712038	MAG	Sweden	Europe

• Gene Location: Start: 140194; End: 141597 Strand: +

Full Sequence      

MMDTFKLFFSCVGVFFILYMIGYASFLFLAVTVGSSTLYQLRRRNQLKNELLQHYYVPVT
IVVPAHNEEVTIQSTVQSLLSLEYTLYEIVIVDDGSTDQTAQLLRETFRMHQVARPIHRS
IPCQEAVAVFETQEFKVPITLICKKNGGKADALNMGINASRYPYFICMDADSVLQYDSLE
KIVRPVLEDGNVVAVGGAVRPCNGAEIQNGRVISYHMPRQILPCMQVLEYDRSFLAARIL
FDKFNGSIIISGAFGLFKKSVVIDAGGYDATTMGEDMELVVKLHVFCREHGLAYRVRYAT
DAICWTQAPEKLEDLCKQRRRWHIGLFQTMTRHRRMLANPKYGLVGLISYLYFLIYELLS
PYIELFGLATIAVAFAVDLINVPFMILFFIIYVLYSAILSLTAFFARIHTIDLKLIFSDV
LKAIGLCVLEVSCLRFILAWVRATALIGYKKKKQAWGTIERKKINFD

Enzyme Prediction     

No EC number prediction in MGYG000001742_00140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	60	242	1.6e-26	0.8588235294117647
GT2	164	390	6.9e-19	0.9441624365482234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.40e-60	61	276	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	4.06e-50	1	461	9	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	7.85e-46	1	404	3	342	N-glycosyltransferase; Provisional
pfam00535	Glycos_transf_2	7.98e-28	60	262	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK14583	hmsR	2.18e-26	59	336	77	319	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL04658.1	1.65e-198	12	465	19	472
QNK56534.1	1.62e-194	1	467	1	467
BAN78238.1	3.05e-193	8	464	13	469
QUO31269.1	1.87e-183	1	463	1	463
QBE99872.1	2.43e-167	1	467	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.48e-07	59	195	7	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
2Z86_A	3.77e-07	39	259	358	554	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	3.77e-07	39	259	357	553	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RQP9	1.59e-29	59	332	49	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q5HCN1	1.59e-29	59	332	49	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.59e-29	59	332	49	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.59e-29	59	332	49	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q99QX3	1.59e-29	59	332	49	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000024	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
15	37
342	364
384	406