CAZyme Information: MGYG000001933_00211

Basic Information

• Species: Prevotella sp900544495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544495
• CAZyme ID: MGYG000001933_00211
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1263		143341.91	6.2394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001933	2797127	MAG	Denmark	Europe

• Gene Location: Start: 106137; End: 109928 Strand: +

Full Sequence      

MPCSDINELEELLQTLRQSKTIQHINLLVNGNSRICQCEDGKKCIDDITFINVDNPNASR
TLLEVEANTDAEYVLLNLKATPVNLGQHALDRMLRVATDSGAGMVYADSYIQKDGQTEKH
PAIDYQKGSIRDDFDFGQLLLIRSSLLHDYAAKQQKADYKYAGLYDLRLYISRKAEIFHI
NEYLYTQIETDFRKSGERQFDYVNPRNREVQVEMEQAATRHLEKIGATVDTSHYRKPDFS
EQDFCCEASVVIPVYNRAKTVADAVKSALSQKTTFKYNVIVVDNHSTDGTFEILNDIAKE
DKRLIHIVPTRTDLGIGGCWNVAIDDERCGRFAVQLDSDDLYSSPQTLQRIVDEFHRQGA
AMIIGSYRMCNFQLETLPPGLIDHSEWTDLNGPNNALRINGLGAPRAFFTPILRQIQFPN
TSYGEDYALGLAFSRKYRIGRIFDELYLCRRWDGNSDAALSIERQNANNLYKDRLRTLEI
SARQQMSAGNSDATTDSSLQRFFNRQLEVWDDARHHFHDLRNVKTRELTCGEITLKLQFN
PARIVSTGANIEKKAIAKRPCFLCEQNRPAEQMQKHIDKNFTLLVNPFPIMPQHFTIPLR
AHRPQSIGLNYGEVYRLLDTYPTLTVFYNGPKCGASAPDHMHFQAICSGMLPLQNDWARL
SHDLDILIKKDDKGELAALKNTPIPLFVIRCADRSTGEQLFRNLYASLPMHGGDTEPMMN
ILAWRDGDSYLSVVIPRSKHRPDCYFSNGDAQRLVSPGALDMAGFIVTPRREDFEAITSD
EALSILKECGMKQSEFAETVEKLRTRSNEASQDNHFAGKQPSVSVGIVSGAKISFSLNKP
YMAKGNLIEGEQTVEFHEGGILWNGMQYRELTFHPQSADASFSLHDVTIGVNFHWERQET
QTFLGSLRLVVDSDKVCAINELPVETYLESVISSEMSATSSIELLKAHAVISRSWLLAQI
EQRRKQQTSAGQNGFFSFIRKDDELIKWYDREDHTIFDVCADDHCQRYQGITKATSPQVA
QAIHATRGQILLNDNEICDARFSKCCGGTTEEFQYCWENIKKPYLVAVRDLAPVKGKDDA
DCNLPDLTIEANAEQWIRTAPESLCNTNDRQILSEVLNDYDQETTDFYRWHVTYTQEQLQ
SLVTERLKIDFGNIVDIIPVERGRSGRICRLKIVGTKHSFTIGKELEIRRALSYTHLYSS
AFVVDKEDVKDGVPQTFRLTGAGWGHGVGLCQIGAAVMGAKGYNYDQILLHYYRGAEIKK
IYK

Enzyme Prediction     

No EC number prediction in MGYG000001933_00211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	249	373	6.3e-22	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	2.38e-96	610	797	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	8.86e-47	918	1260	2	267	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	6.74e-42	919	1261	139	393	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	1.89e-31	918	1261	68	338	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	2.01e-28	913	1031	2	99	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84357.1	0.0	1	1263	9	1253
QNT65264.1	0.0	1	1263	9	1260
QVJ80566.1	0.0	1	1262	9	1223
ADE82754.1	0.0	1	1262	9	1223
QYR11045.1	0.0	1	1263	8	1246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	3.72e-09	906	1259	50	318	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	8.57e-08	921	1262	63	330	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	9.71e-08	921	1262	87	354	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QYX7	6.33e-10	903	1258	88	351	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P07372	2.15e-07	918	1260	71	331	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1
Q57022	7.80e-07	249	431	7	180	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
Q57287	7.96e-07	245	466	4	230	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
O32268	7.97e-07	249	365	9	122	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001933_00211.