CAZyme Information: MGYG000001976_01009

Basic Information

• Species: Sutterella seckii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella seckii_A
• CAZyme ID: MGYG000001976_01009
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883		99340.97	8.7269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001976	1701575	MAG	Denmark	Europe

• Gene Location: Start: 1006; End: 3657 Strand: +

Full Sequence      

MQPRSTLNPRSYLRERLSLWKANGAGKSAIAVNAFFLALFLLIVPIEREPFRSIARRKAY
FYPQVDFDRPRLLDPLRLVIQTFWLLCVKPSDPYHPVRSPWSRLVEAVVRILRALGAVIS
RIGSAWGTFCLALVRRLPALSDQGEKSEGGAGRGQTFLVWTIVLLGLALAALCITQPFTL
EGQVVFLSFMFFSMIALVRVKARITLMLLFVISIVVSGRYLWWRATATLNTNTWLDVLFT
SLLLGAELYAFAVMCFGYFQVCWTLDRKICPLPEDRSVWPDVDVFIPTYNESLDVIKPTV
FAALNLDWPKEKLHVHILDDGSRDAFKLFADEVGAGYIKRDEHMHAKAGNINHALTVTSG
EHIVIFDCDHVPSKDFLVSTVGWLVKDPMIALVQTPHHFYSPDPFEKNMHLDRALPIENS
LFHDFIQKGNDTWNATMFCGSSTVMRRKALLEVGGIAVETVTEDAHTSLKLNRRGWKSAF
IERPVASGLSTDTLAAHIGQRIRWARGMIQILRLDCPLLGRGLTLAQRLCFFNAMLHFLH
GLPRIIFLLAPLPYMLADVYVIYATAASIFAYVIPHMVHSAVTNQRLQHGYRYPFLSGVY
ETVLAWYILIPTTVALIAPTIGKFNVTAKGGTIDSKYLDWHISKPYLVLIALNFAGLLAG
FWKAFASPDPEYLTLAINMGWIVYNLMVLGATMAVAVEDVQKDKFPRVPLKLAAKATLPD
GSELPVEVCEFSQEGVRVLAPEGNEVVFEALQKMPAGEALQIELPADDGRTEVFRANVAP
EDPTRTDLPKGGRDLVFKFEGYADERRFNSLTFSRRGIWAKKPDETIDDRFITGFLELGR
IALYGNRSMIEFLPGRMLPALRDLIASLLPRTPRREQDLANLR

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	283	453	1.2e-35	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11498	bcsA	0.0	10	875	1	845	cellulose synthase catalytic subunit; Provisional
TIGR03030	CelA	0.0	153	845	7	701	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
cd06421	CESA_CelA_like	3.32e-113	280	512	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	3.44e-52	237	692	10	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	4.06e-34	280	507	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53875.1	0.0	1	883	1	883
QQS88758.1	0.0	16	873	16	860
QQQ96025.1	3.57e-291	13	854	14	848
ANU67170.1	3.57e-291	13	854	14	848
QDA53780.1	1.16e-256	134	857	33	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.15e-239	20	877	24	860	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	7.47e-106	157	739	7	606	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.38e-105	157	739	19	618	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.49e-105	157	739	20	619	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L7	6.26e-241	20	877	24	860	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q93IN2	9.45e-241	13	876	17	859	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	2.67e-240	13	876	17	859	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P37653	3.54e-240	20	877	24	860	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
P58931	4.46e-211	138	863	9	737	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999951	0.000075	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
29	46
156	178
183	200
205	222
237	259
545	567
603	625
646	665
675	697