CAZyme Information: MGYG000002195_02661

Basic Information

• Species: Emergencia sp900551775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Emergencia; Emergencia sp900551775
• CAZyme ID: MGYG000002195_02661
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478		55245.73	9.5209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002195	4665652	MAG	Spain	Europe

• Gene Location: Start: 8498; End: 9934 Strand: +

Full Sequence      

MTWLRVIVEFINVFFFIYMTGYAMFLFLSAISGAIVMHKNAKRSRFRKRLYLEHSENYQP
VSLLVPAYNEEETILDAIHSLMKIDYAEYEIIVINDGSTDRTAEQLIDLFNMKKIERPVR
RQVRSKKIFDIWEAVDTKVPLTLVNKENGGKADALNTGINAARYGFFMSMDADSVLQRDA
LKKMMEQFIADRTVIACGGNIMVANQAVIQDGEVISNYFPRKLVVLMQLLEYCRSFLGSR
IFFDAFGGNLIISGACGLFKKNIVIQAGGYNTDTVGEDMELVVKLHHFCRSNQIPYRIVN
EQMAVCWTQVPERISDLRKQRRRWHMGMIQSIILHRELIFNGAYGLTSFISMTYYLIMES
LGPLIEVIGLVNIILAMNLEMINIDFMISYYFLFLLFSAAVTVITFFSRIYMSAFKVTFW
QVIVVVISSVLEGLGFRQMVTFFRLSAFIHYNKNKTEWGKIKRKTHYRANPNENGRNK

Enzyme Prediction     

No EC number prediction in MGYG000002195_02661.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	62	199	2.2e-24	0.6705882352941176
GT2	168	394	7.1e-16	0.9390862944162437

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.76e-59	63	278	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	6.43e-51	2	341	1	292	N-glycosyltransferase; Provisional
COG1215	BcsA	2.19e-48	1	472	1	433	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	2.38e-25	62	264	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	6.93e-24	64	243	2	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ70189.1	2.10e-140	4	464	2	463
QYE99155.1	1.28e-139	4	464	2	463
QNK56534.1	4.66e-139	4	463	5	461
CEJ73226.1	5.14e-139	4	464	2	463
AUN13884.1	2.06e-138	4	464	2	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	6.12e-07	56	205	2	120	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
6P61_A	1.17e-06	61	179	15	108	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	2.44e-32	22	327	10	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	8.67e-32	49	327	35	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q7A351	5.23e-30	15	327	3	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q9RQP9	5.23e-30	15	327	3	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	5.23e-30	15	327	3	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
338	357
361	383
390	412
417	436