CAZyme Information: MGYG000002481_00936

Basic Information

• Species: Stenotrophomonas maltophilia_F
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_F
• CAZyme ID: MGYG000002481_00936
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		41781.09	10.0455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002481	4867831	Isolate	United States	North America

• Gene Location: Start: 8739; End: 9878 Strand: -

Full Sequence      

MKTLLFLAMCAFILVRVCVQASRRPSTRLYSIDAIVPAYNEAPCLERSLTGLLQNPYVAR
VICVNDGSTDNTAQVLDALQARWPGRLVAVHQANTGKGGALMHGLRHATAEQVFLTDADT
HIDPRGHGLGHLLDEIERGADAVGGVPSSSLQGAGFLPHVRASLKLPMIVIKRSFQQWLG
GAPFIVSGSCGLFRTSVLRKVGFSDRTRVEDLDMSWSLVAQGYRVRQSVRCVVYPQECNT
LVEEWRRWRRWIVGYAVCMRLHRGLLLTRFGVFSILPMMLLALAGIVLTLQVWFGAAQLH
GPGGLALSVMPLFWIGIVMLLAVISAIHHRRASLVPAAAFSMLYVLLAYAIWLMHGVAGL
FTGREPARDKPTRYPHVVE

Enzyme Prediction     

No EC number prediction in MGYG000002481_00936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	34	201	1.1e-28	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.26e-42	4	352	28	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.34e-31	35	211	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.04e-30	35	322	59	352	N-glycosyltransferase; Provisional
pfam00535	Glycos_transf_2	3.97e-29	33	198	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04179	DPM_DPG-synthase_like	4.57e-27	35	201	2	166	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCB33872.1	1.23e-277	1	379	1	379
QGL82844.1	1.23e-277	1	379	1	379
QNG84847.1	1.23e-277	1	379	1	379
QNG89483.1	1.23e-277	1	379	1	379
AWB76649.1	1.23e-277	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	5.35e-08	32	224	44	235	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	5.37e-08	32	224	45	236	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47536	1.75e-169	1	379	1	379	Uncharacterized glycosyltransferase YaiP OS=Escherichia coli (strain K12) OX=83333 GN=yaiP PE=3 SV=2
Q8GLC5	6.42e-17	32	254	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	8.65e-17	32	254	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q5HCN1	3.83e-16	29	254	46	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	3.83e-16	29	254	46	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999152	0.000149	0.000133	0.000124	0.000126

TMHMM  Annotations     

start	end
176	198
266	288
303	325
332	354