CAZyme Information: MGYG000002593_00039

Basic Information

• Species: Limosilactobacillus sp900557215
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus sp900557215
• CAZyme ID: MGYG000002593_00039
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	MGYG000002593_1|CGC1	51355.57	9.0855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002593	1475799	MAG	China	Asia

• Gene Location: Start: 38432; End: 39757 Strand: +

Full Sequence      

MVSNIFTDIFHSGSPLSMVLIAVLFILCIYPILGSLFWFFGAVSYVIFRRKDELPHQHQL
KHEPFITIMIPAHNEELVIQSTLDYLLTQLNYHNYEVLVMDDGSTDSTPDILQAMQQQYS
RLRVIRIKQNQGKAHAFNIGLFYAKGKYILSNDADTIPEKDALVKYMRYFTSPQGINYAA
ITANMDVYNRSSLWGKSQTVEFSSIVEIIKRSQTALNDTMYAYSGANTMYRRDFLINVGG
FRQDRATEDISIAWDHTFMNVTPKFAPDIVFHMNVPETFRDLYHQRKRWAQGGTEVWLTN
FLKVFRHPWQYRFVMPMLIDTTFSIIWSFFFWITSVIFVIVMLYYVMHGNYERVWHGITM
SMIFVNFQLIAGLFQVSAALLLDFNGAKLRYFMFSPIYLLFTWIVNPLTIVTTFHKAVRT
VMGHGSGKWISPARKVSDLNE

Enzyme Prediction     

No EC number prediction in MGYG000002593_00039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	67	238	3.8e-33	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	9.54e-90	15	434	2	416	N-glycosyltransferase; Provisional
PRK14583	hmsR	4.87e-65	13	436	16	439	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd06423	CESA_like	3.09e-57	68	249	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.13e-56	16	435	4	432	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	1.42e-30	67	235	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL77020.1	3.69e-272	1	438	1	438
AKP02107.1	1.50e-271	1	440	1	440
ABQ84127.1	1.50e-271	1	440	1	440
QIZ05157.1	1.50e-271	1	438	1	438
BAG26288.1	1.50e-271	1	440	1	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.09e-10	66	160	7	99	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5EJ1_A	7.30e-09	55	300	119	382	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.58e-09	55	300	131	394	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.58e-09	55	300	132	395	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
2Z87_A	8.97e-09	48	163	358	471	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XAR5	2.90e-50	10	329	24	334	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	5.65e-50	10	329	24	334	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q5HKQ0	3.42e-45	27	434	7	407	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	3.42e-45	27	434	7	407	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q7A351	9.34e-44	27	434	7	407	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
325	347
362	384
391	413