CAZyme Information: MGYG000003390_00259

Basic Information

• Species: Pseudescherichia vulneris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pseudescherichia; Pseudescherichia vulneris
• CAZyme ID: MGYG000003390_00259
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000003390_5|CGC3	98077.17	8.0002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003390	4956281	MAG	United States	North America

• Gene Location: Start: 220858; End: 223419 Strand: -

Full Sequence      

MLPLLFRGLPDKRLSCSMMTHYESEKPFVSVVTPTWQRAAFLPWLIYMFRYQDYPAARRE
LIVLDDSPTSSLAIVNALTDNQPARYNIRYIHHPERLPLGKKRNMLNALAKGEYIICMDD
DDFYPADKLTYTIGMMQRHGTLISGSDQIPVWYSHINRVFKTRAFGKRHILNGTFCYHRN
YLKKHRYDDACQLGEEQAFTNNFSVKPLQLPGERTILCVSHSDNTFDKDFVLGSCEPTSI
SLADIVRDPTLLAWYQRLHNSTDRQPIQWQHVEKVLVINLDRRADRWQQMQETLRQLGVP
KERVIRVSGCEHENGALGRTLSHLQALTLAQQQGWRNCLVLEDDALLLTQAKHVSALNRL
LAALDHLPWEVVLLGARVTTGQPLKSLPGLIHAVDCEKACAYLVNAASYPALIQQMQSDP
ASLLESRWRLMQKQGKWLAFYPCISYQRPGFSDIEQQETDHIRFYFNKMTVSHTQEQQQQ
AQQPVANQFANTVGFYLETAFHYQLYQPILHWLLEAGYRCDLLISDAVPKALLMEMSQLL
ADINDPRLSGSRLSEAQNRKQRYGCLVSPYYTPALNGLGRVQIRAMYGLAKVSWNHAWWN
TFYHHILCYSHYSQQALNINGNATIVGNPRFDKWHRQQVDLASLATLRLDTKKPTLLYAP
TFGDLSSIPAWAAPLSRLSREYNLIIKLHHGTQHHPEEAAMLAEVRRHFKTCVTRHDMLL
PLLHQADYVLTDNSGFIFDAIHAGKRTILLDWEGMSTLLENNRTFSHPSSPEQQLRGTLP
VVRDMAQLRHCLAADYDWRLIEEELSRVRHHYCDAFQDGFAGKRAAELIMNALDNPIDAE
ANTLLHSLQSKLF

Enzyme Prediction     

No EC number prediction in MGYG000003390_00259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	30	144	2.8e-18	0.6529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.02e-16	30	199	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06532	Glyco_transf_25	7.24e-14	274	367	1	127	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
cd00761	Glyco_tranf_GTA_type	2.02e-13	31	165	1	124	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	4.72e-10	28	140	1	110	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG0463	WcaA	8.47e-10	25	186	1	160	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCU56458.1	0.0	27	853	27	853
QCA19732.1	0.0	25	853	23	852
QMR46619.1	0.0	25	853	23	852
ARC41397.1	0.0	25	853	23	852
AUV24995.1	0.0	25	853	23	852

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQ09	2.80e-23	27	294	3	279	Uncharacterized glycosyltransferase L193 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L193 PE=3 SV=1
P77414	4.91e-06	27	138	5	112	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003390_00259.