CAZyme Information: MGYG000003443_00075

Basic Information

• Species: UBA1067 sp900767325
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1067; UBA1067 sp900767325
• CAZyme ID: MGYG000003443_00075
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	MGYG000003443_6|CGC1	68436.09	8.6738

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003443	1101788	MAG	Fiji	Oceania

• Gene Location: Start: 1861; End: 3687 Strand: +

Full Sequence      

MTKLDEKWALTKETVGEDRLSIVMPFYKLADSVVANLTEVGELFERHGVKTELVPVDDGS
LDGTDRLLGEFAVSAARWQYVTVTPVICPRNGGKGAALRAGFEASSGRYVMLLDGDLDIS
PKQTPYFFETLVTKGADIAVGSKRHPRSVVQYPWHRRIVSHCYYTLVKWFVGLPVTDTQT
GMKLFKREVLGPALARMLVKTYAFDLELLAIAASRGAKVVEAPVVISFGDKFGALSATTV
WKMSLDTLAVFYRLRLLRYYAKCLVPKKLDHDPLVSVVIACPKRSAMLEECLRAIRAQSY
PHWECLVLPDEDEGGASAEGVRFIPTGRVRPAEKRNIGIREAKGEVVAFIDDDAYPDAHW
LEYAIKYFGDADIGAVGGPAVTPPGDGLLARLGGRVYDNYLVSGNYHYRYKAGGVRMDVD
DYPSCNLFVRKATLERIGGYRTDFWPGEDTLLCKDIVDSWKRIIYDPWVVVFHHRRPLFG
PHLRQLGRYAFHRGYFCKRYPSNSLRPSYFVPTLFDLYLALLGTIGLFNLSGIDCLRVTF
HRWGGYLPFWIYLALVALTTFSFKPHHWLLTFCGVVASHVWYGVRFFQGLCARKAPCEYI
GKDHANGE

Enzyme Prediction     

No EC number prediction in MGYG000003443_00075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	21	190	1.3e-17	0.9705882352941176
GT2	276	427	5.5e-17	0.9352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04188	DPG_synthase	9.69e-44	22	224	1	202	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
cd04179	DPM_DPG-synthase_like	7.19e-42	22	212	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd02525	Succinoglycan_BP_ExoA	1.74e-32	274	515	1	248	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd06442	DPM1_like	3.73e-29	22	230	1	201	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
PTZ00260	PTZ00260	4.47e-25	20	259	72	323	dolichyl-phosphate beta-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTM03308.1	6.05e-122	20	589	7	589
QTM05871.1	1.70e-121	20	589	7	589
QTM11098.1	1.70e-121	20	589	7	589
QTM08543.1	4.76e-121	20	589	7	589
ANN63865.1	9.46e-121	20	589	7	589

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40350	8.82e-16	20	263	75	334	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
O60061	1.15e-13	6	224	54	278	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
A5GFZ5	4.15e-13	7	231	13	233	Dolichol-phosphate mannosyltransferase subunit 1 OS=Sus scrofa OX=9823 GN=DPM1 PE=3 SV=1
Q9VIU7	4.23e-13	19	251	7	238	Dolichol-phosphate mannosyltransferase subunit 1 OS=Drosophila melanogaster OX=7227 GN=Dpm1 PE=3 SV=1
Q54LP3	2.32e-12	11	236	11	232	Dolichol-phosphate mannosyltransferase subunit 1 OS=Dictyostelium discoideum OX=44689 GN=dpm1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
508	530
543	562
567	584