CAZyme Information: MGYG000003630_00594

Basic Information

• Species: F082 sp900771045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900771045
• CAZyme ID: MGYG000003630_00594
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		72644.9	9.133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003630	1926154	MAG	Fiji	Oceania

• Gene Location: Start: 8882; End: 10822 Strand: -

Full Sequence      

MKLSVVIVNYNVEHFLEQCLLSVRRAMRGVDGEVFVVDNNSVDGSLKMLAAKFPEVKVIA
NKENVGFSRANNQAIRVSGGEYVLLLNPDTVVEDDTFVKVLDFMDSHPDAGGLGVKMVDG
KGCFLPESKRGLPTPMTAFYKIFGLSKLFPKSKRFGRYHLGFLDENETNEVDVLSGAFML
LRRAALDKSGLLDETFFMYGEDIDMSYRITLAGYKNYYFHDTRIIHYKGESTKKTSVNYV
IVFYKAMEIFAKKHFAKDGAWFLSFLINTAIYLRAGAAIFSRFLSCVAQPLTEAVTGFAG
LAVISGLWGHFSVYDGIGNYPRMLFTIVIPLYILIWIASSYVIGGYDRPYRKTPSMVGNV
VGMLVILVIYALLPEEMRFSRALILFGTAWMCVVSLLTRGIGRLIGLANYKPEHSKHRFL
VIGNADEVRRVATLLESTAIKPDYICNVLPDEDAELPEGYVGCLRQVPDIAAIYKIDEVI
FCAKDVPNAVIIDKMVAWQELGLDYKIAPEDALSIIGSNSINTRGDLYTVTVNTIVTVRN
KRRKRLFDLSVACIVIFSWPLTAWFVKNPVSLLKNGVRVLFGRRTWVGFCSSDTRLPILK
KHIFTTAMLLKNKKIDSKTAYEIDVRYAQDYKLVTDLNIFLEAVKK

Enzyme Prediction     

No EC number prediction in MGYG000003630_00594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	188	4.6e-24	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	9.85e-56	5	227	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.82e-52	1	284	3	279	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.60e-24	4	186	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	1.56e-20	4	239	3	220	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam13641	Glyco_tranf_2_3	2.92e-18	3	235	4	220	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY45414.1	3.75e-218	1	645	1	646
QIA08556.1	1.25e-213	1	646	1	648
AHW61351.1	2.87e-212	1	645	1	647
AEV32005.1	2.75e-210	1	645	1	648
ASS48316.1	8.92e-209	2	646	7	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	3.14e-06	4	125	16	140	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5MLZ_A	9.40e-06	1	120	23	143	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	8.90e-20	3	261	5	268	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	8.90e-20	3	261	5	268	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P46918	1.85e-09	4	107	11	118	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1
D4GU63	4.06e-09	3	208	20	205	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
E0U4V7	3.22e-08	1	128	1	132	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
259	281
294	313
323	345
357	374
379	401
549	566