CAZyme Information: MGYG000004083_00563

Basic Information

• Species: CAG-1427 sp000435675
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp000435675
• CAZyme ID: MGYG000004083_00563
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000004083_1|CGC2	95065.88	4.9237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004083	1867105	MAG	United Kingdom	Europe

• Gene Location: Start: 621307; End: 623811 Strand: -

Full Sequence      

MNVTFKIMRRSGDKAYILSEITDYDKGLPVVLSASTENGVRIPCDVFPFVDEDDVLAMEF
ALYDTALAVRDDLLASAHAKNSPALRFFVVVLPWLNVKRWVLEFRAITPEGKTQSFCVNG
LEMDAFRWRNRLDIRRGAFQSEALEQLSKRFIHDRIQISFKRALDMGDRLLVSAALDMPY
HEESDIAFDFLDGEGRPFEPYFNVIENSVTHASDFGSLERRNLELSISLPKAIGEMCVCA
TDTAGTIAPGFEVLSEKGAHALLEEFAEQTRTAYNDPAYDEWYRTHQRADLPTLFEQVSV
RFKVEPLISIVCVLDHAQHHQIHDVMNAFRTQSYSKWELIFVDLDGDDSFVSSLLEVFQD
DRMYLVDVDPALSRPEKINAAFYAAEGSYIGSLFAHDLLAPNALFECVRTINAFPTCELI
YCDSDTVNVQGYHSHPILRSAYSPELLRSFNYLGNFVIYGVELLERIGLLDPAFEGALAY
DLNLRACEQAQRVCHISRVLCHRRFASEMYEYQLHSPEDQEAGRKALVAHCKRVGISAEV
LSLDIPFCYRIRHVLTETPKVSIVLNTVNNADVIERCVTSLYQQISYDNFEVVVVEVGKL
DAHVKDTLARLRERFSTFRTLHYDGVFNHARLANFAVEQLSSEYFFFITDDTRILTPDAL
QTMLGYFQDEQVGIVGPQKLYLDATIEHAGLVVGGEHVITPISRYMLSDWNGYLDRCAVS
RNVSAVAGECMFISKEVFDQVGGFTEDFSLAYSDVDFCLKARELGFYTVYTPYVKLTHSR
SVNRMRNYSQAFLIKRTREAALIQYLWPDYFVKGDGFYNPNLDPNNPYFALRKD

Enzyme Prediction     

No EC number prediction in MGYG000004083_00563.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	559	799	4.3e-21	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.44e-46	330	504	25	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.39e-29	562	778	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.83e-20	558	798	2	240	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06423	CESA_like	1.35e-15	569	747	7	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.14e-14	559	799	2	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	9.98e-150	1	831	1	829
QOY61397.1	1.50e-102	88	831	55	801
ACV56016.1	6.75e-102	86	828	43	788
AZH69456.1	3.51e-101	88	831	74	823
QOY61387.1	1.93e-99	86	827	58	802

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.68e-69	287	831	347	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.38e-60	270	833	280	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004083_00563.