CAZyme Information: MGYG000004101_00643

Basic Information

• Species: CAG-302 sp900548425
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-302; CAG-302 sp900548425
• CAZyme ID: MGYG000004101_00643
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		43306.94	9.3279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004101	1331726	MAG	United Kingdom	Europe

• Gene Location: Start: 74821; End: 75903 Strand: -

Full Sequence      

MNKYKVIVYAICKNEEKYVDKWYDSVKEADKIFVLDTGSTDNTIRRLKEKDKVVVKEEKI
IPWRFDIARNKSLDMVDKNSDICVCIDLDEVLIKGWRKLLEKHWKEDTTRCMYTYNWSLD
KNDKPIISFYYEKIHSRYGYKWIYPVHEILTYDGKENKIIIEDLIVNHYPDITKSRSSYL
PLLELSVKEEPNNDRNMHYLGREYMYYGKYNKAIDTLIKHLKLDSATWKDERAASMRFIG
RCYTNLNRYEEAILWYKKAIKEAPYLRDGYIEIAILYNLLDDYNKVIYYTNKALKINKKE
KTYINEVFSYNSTAYDLRSIAYYYLGKYKASLKNIKKAITMEPNNERFISNKKIIEDKLK

Enzyme Prediction     

No EC number prediction in MGYG000004101_00643.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	3.79e-11	233	339	1	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	2.30e-10	197	295	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
cd02511	Beta4Glucosyltransferase	3.60e-09	5	170	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	2.19e-06	180	261	21	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam00535	Glycos_transf_2	7.02e-06	6	147	2	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT50106.1	5.76e-128	1	358	1	359
QNK42027.1	7.16e-125	1	360	1	361
AQS58818.1	6.73e-124	1	358	1	359
AQS58819.1	5.83e-123	1	359	1	360
QOX65321.1	1.06e-122	1	359	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004101_00643.