CAZyme Information: MGYG000004261_00077

Basic Information

• Species: UMGS1449 sp900551925
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1449; UMGS1449 sp900551925
• CAZyme ID: MGYG000004261_00077
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000004261_5|CGC1	42578.07	5.0384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004261	785527	MAG	China	Asia

• Gene Location: Start: 7525; End: 8598 Strand: +

Full Sequence      

MKIIVYAISKNEEKFVKRWYESMKEADDIYVLDTGSTDNTVNLLQELGVNVKTETISPWR
FDIARNKSLDFVPKDADICICTDLDEVFESGWRKILEENWNNSSRAQYTYNWAFNEQDKP
IVTFYISKIHTRNNYKWTHPVHEVLTYTGDEPEKLTTIENIVLNHYPDSTKSRSSYLPLL
ELSVQEDPEDDRNMHYLGREYMYYEKNDEAIETLKKHLTLKSATWKDERCASMRFIARCY
SRKNDIENAIIWYDNAIKEAPYLRDAYVEKALLLYNQKNYNEVIYLCNQALDIKDKQKTY
INEVFSYDHTIYDLLSLCYYYKNEKELALYYIDKAIEKSPDIKRLQDNKLLMEKLSN

Enzyme Prediction     

No EC number prediction in MGYG000004261_00077.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	9.92e-11	2	167	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	2.55e-09	236	337	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.20e-08	194	292	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR04195	S_glycosyl_SunS	1.28e-06	3	317	63	381	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
COG0463	WcaA	1.80e-05	1	280	3	279	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	2.12e-124	1	348	4	352
QOX65321.1	6.70e-123	2	355	5	360
AQS58819.1	1.71e-121	1	348	4	352
ANU42689.1	6.55e-121	1	348	1	350
QQR04409.1	6.55e-121	1	348	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSN_A	9.68e-07	3	279	60	341	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XC90	1.63e-06	2	83	4	84	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1
O31986	5.30e-06	3	279	60	341	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	5.30e-06	3	279	60	341	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004261_00077.